Gene Details:
- Gene ID: AT1G01360
- Gene Symbol: PYL9, RCAR1
- Gene Name: PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1
- Description: regulatory component of ABA receptor 1;(source:Araport11)
- TAIR Accession: locus:2035227
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0000013 — cauline leaf — hoja caulinar (Spanish, exact), 茎生葉、茎葉 (Japanese, exact)
- PO:0000230 — inflorescence meristem — meristema de la inflorescencia (Spanish, exact), 花序分裂組織 (Japanese, exact)
- PO:0009010 — seed — semilla (Spanish, exact), 種子 (Japanese, exact), pyrene (narrow), diaspore (broad)
- PO:0009030 — carpel — carpelo (Spanish, exact), 心皮 (Japanese, exact), Poaceae carpel (narrow), Zea carpel (narrow), pistil (broad)
- PO:0009032 — petal — pétalo (Spanish, exact), 花弁 (Japanese, exact)
- PO:0009047 — stem — caña (Spanish, exact), culm (exact), eje primario (Spanish, exact), primary axis (exact), primary stem (exact), tallo (Spanish, exact), tronco (Spanish, exact), 茎 (Japanese, exact), bole (narrow), cane (narrow), caudex (narrow), caudices (narrow), core (narrow), primocane (narrow), scape (narrow), stalk (narrow), trunk (narrow)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0000084 — plant sperm cell — célula espermática o esperma (Spanish, exact), male gamete (exact), microgamete (exact), 植物精子細胞 (Japanese, exact), sperm nucleus (related), sperm cell (broad)
- PO:0025195 — pollen tube cell — célula del tubo polínico (Spanish, exact), 花粉管細胞 (Japanese, exact)
- PO:0000293 — guard cell — célula guardiana (Spanish, exact), occlusive cell (exact), 孔辺細胞 (Japanese, exact)
Gene Ontology:
- GO:0005515 — enables — protein binding
- GO:0042803 — enables — protein homodimerization activity
- GO:0010427 — enables — abscisic acid binding
- GO:0005737 — is active in — cytoplasm
- GO:0005737 — located in — cytoplasm
- GO:0009738 — involved in — abscisic acid-activated signaling pathway
- GO:0038023 — enables — signaling receptor activity
- GO:0005634 — located in — nucleus
- GO:0004864 — enables — protein phosphatase inhibitor activity
- GO:0005634 — is active in — nucleus
Function-related keywords:
- cauline leaf , inflorescence meristem , seed , carpel , petal , stem , pollen , plant sperm cell , pollen tube cell , guard cell
Literature:
- Functional analysis of an Arabidopsis transcription factor, DREB2A, involved in drought-responsive gene expression. DOI: 10.1105/tpc.105.035881 ; PMID: 16617101
- A comparison of the Thlaspi caerulescens and Thlaspi arvense shoot transcriptomes. DOI: 10.1111/j.1469-8137.2006.01662.x ; PMID: 16608451
- Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. DOI: 10.1104/pp.106.082289 ; PMID: 16920880
- Exploiting the wild crucifer Thlaspi arvense to identify conserved and novel genes expressed during a plant's response to cold stress. DOI: 10.1007/s11103-006-9080-4 ; PMID: 16972165
- Dual function of an Arabidopsis transcription factor DREB2A in water-stress-responsive and heat-stress-responsive gene expression. DOI: 10.1073/pnas.0605639103 ; PMID: 17030801
- Regulation and functional analysis of ZmDREB2A in response to drought and heat stresses in Zea mays L. DOI: 10.1111/j.1365-313X.2007.03034.x ; PMID: 17346263
- LEA (late embryogenesis abundant) proteins and their encoding genes in Arabidopsis thaliana. DOI: 10.1186/1471-2164-9-118 ; PMID: 18318901
- Analysis of the Arabidopsis histidine kinase ATHK1 reveals a connection between vegetative osmotic stress sensing and seed maturation. DOI: 10.1105/tpc.107.055871 ; PMID: 18441212
- Proteome-wide characterization of seed aging in Arabidopsis: a comparison between artificial and natural aging protocols. DOI: 10.1104/pp.108.123141 ; PMID: 18599647
- The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors. DOI: 10.1093/jxb/ern155 ; PMID: 18552355
- Arabidopsis DREB2A-interacting proteins function as RING E3 ligases and negatively regulate plant drought stress-responsive gene expression. DOI: 10.1105/tpc.107.057380 ; PMID: 18552202
- Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106. DOI: 10.1104/pp.108.126979 ; PMID: 18805951
- Disease-specific expression of host genes during downy mildew infection of Arabidopsis. DOI: 10.1094/MPMI-22-9-1104 ; PMID: 19656045
- Arabidopsis NDR1 is an integrin-like protein with a role in fluid loss and plasma membrane-cell wall adhesion. DOI: 10.1104/pp.110.169656 ; PMID: 21398259
- Increased expression of a phloem membrane protein encoded by NHL26 alters phloem export and sugar partitioning in Arabidopsis. DOI: 10.1105/tpc.113.111849 ; PMID: 23715470
- Functional characterization of selected LEA proteins from Arabidopsis thaliana in yeast and in vitro. DOI: 10.1007/s00425-014-2089-z ; PMID: 24841476
- The ubiquitous distribution of late embryogenesis abundant proteins across cell compartments in Arabidopsis offers tailored protection against abiotic stress. DOI: 10.1105/tpc.114.127316 ; PMID: 25005920
- Overexpression of Late Embryogenesis Abundant 14 enhances Arabidopsis salt stress tolerance. DOI: 10.1016/j.bbrc.2014.10.136 ; PMID: 25450686
- Functional Analysis of MAX2 in Phototropins-Mediated Cotyledon Flattening in Arabidopsis. DOI: 10.3389/fpls.2018.01507 ; PMID: 30386362
- GmWRKY16 Enhances Drought and Salt Tolerance Through an ABA-Mediated Pathway in Arabidopsis thaliana. DOI: 10.3389/fpls.2018.01979 ; PMID: 30740122
- Solution structure of a late embryogenesis abundant protein (LEA14) from Arabidopsis thaliana, a cellular stress-related protein. DOI: 10.1110/ps.051579205 ; PMID: 16155204
- Li(+)-regulated 1-aminocyclopropane-1-carboxylate synthase gene expression in Arabidopsis thaliana. DOI: 10.1046/j.1365-313x.1996.10061027.x ; PMID: 9011084
- Characterization of two members (ACS1 and ACS3) of the 1-aminocyclopropane-1-carboxylate synthase gene family of Arabidopsis thaliana. DOI: 10.1016/0378-1119(95)00694-x ; PMID: 8566772
- The nucleotide sequence of the 5' flanking region of the Arabidopsis ACS2 gene. DOI: 10.3109/10425179309020840 ; PMID: 8219282
- The 1-aminocyclopropane-1-carboxylate synthase gene family of Arabidopsis thaliana. DOI: 10.1073/pnas.89.22.11046 ; PMID: 1438312
- Cloning, genetic mapping, and expression analysis of an Arabidopsis thaliana gene that encodes 1-aminocyclopropane-1-carboxylate synthase. DOI: 10.1073/pnas.89.20.9969 ; PMID: 1357670
- Biochemical diversity among the 1-amino-cyclopropane-1-carboxylate synthase isozymes encoded by the Arabidopsis gene family. DOI: 10.1074/jbc.M308297200 ; PMID: 12968022
- Heterodimeric interactions among the 1-amino-cyclopropane-1-carboxylate synthase polypeptides encoded by the Arabidopsis gene family. DOI: 10.1073/pnas.0308515101 ; PMID: 14983000
- Unique and overlapping expression patterns among the Arabidopsis 1-amino-cyclopropane-1-carboxylate synthase gene family members. DOI: 10.1104/pp.104.049999 ; PMID: 15466221
Sequence:
cDNA Sequence
- >AT1G01360.1 TTAGTATCTTGTTGTGTTTTTGTTTGGTTTGAAAAGCTGAAAATGTGTGAAGGAGAAGAAGGAAGCTATAAAAAAGAGTTTAGGTACAAAAGTAAAAAGTTATTATGTCGGTGGGTTCATTAAAAGAAACCAAAAAACATAAACAAGTAATTTTGTTTTGGCATAACGAAGCATCTTCTTCTTCTTCCTTGTATTTATTATCCATTTCCAGAGATTCTCCCTTGTGAGATAACAACGAAGAACGAAAGAGAGAGAGAGAGAGAGAGATATGATGGACGGCGTTGAAGGCGGCACGGCGATGTACGGTGGTCTCGAGACGGTGCAATACGTACGGACGCATCATCAACATCTGTGCAGAGAAAACCAGTGTACCTCTGCTCTTGTCAAACACATCAAAGCTCCTCTTCATCTCGTTTGGTCACTTGTACGGAGATTTGATCAGCCGCAGAAATACAAACCGTTTGTGAGCAGATGTACAGTAATCGGTGATCCTGAAATCGGCAGTCTTAGAGAAGTCAATGTTAAATCTGGTCTTCCTGCAACAACATCTACTGAGAGATTAGAACTTCTTGATGATGAAGAACACATCCTCGGTATCAAAATCATCGGTGGTGATCACAGACTTAAGAATTACTCGTCGATTTTGACGGTTCATCCGGAGATAATCGAGGGAAGAGCAGGAACGATGGTGATTGAATCGTTTGTAGTTGATGTTCCTCAAGGTAACACAAAGGATGAGACTTGCTACTTTGTTGAAGCACTTATCAGATGTAATCTCAAGTCACTAGCAGATGTTTCTGAAAGATTGGCTTCTCAGGACATTACTCAGTGAACTACATAATCAATGAACAAGGGCATTGAAGTGAAGTATCAATTCCAGTTTGTGATATAATCAATATTCTTCAGGATTTTTTTGGTTTGGCCTAGATATATATATAGATATCTATCCTCGGTAATGACCAGTCTAAAAAGATGTACATATTGTCCCAATGGTGAAGTTTTGATGTAAGATATCTCCTGGTGGTTTGTTATTTGTAGATATTTTTGTAAACAATGTAAATGTGAATGGTTTATGATGTATAATATATAGTTCACAAAAGATGTTTCTGTAGACTTCAGATTCCACTTCTCTATTGAACAGAACCTATGATTGGATGCTGAGAACTTGTAAAGAATCTG
CDS Sequence
- >AT1G01360.1 ATGATGGACGGCGTTGAAGGCGGCACGGCGATGTACGGTGGTCTCGAGACGGTGCAATACGTACGGACGCATCATCAACATCTGTGCAGAGAAAACCAGTGTACCTCTGCTCTTGTCAAACACATCAAAGCTCCTCTTCATCTCGTTTGGTCACTTGTACGGAGATTTGATCAGCCGCAGAAATACAAACCGTTTGTGAGCAGATGTACAGTAATCGGTGATCCTGAAATCGGCAGTCTTAGAGAAGTCAATGTTAAATCTGGTCTTCCTGCAACAACATCTACTGAGAGATTAGAACTTCTTGATGATGAAGAACACATCCTCGGTATCAAAATCATCGGTGGTGATCACAGACTTAAGAATTACTCGTCGATTTTGACGGTTCATCCGGAGATAATCGAGGGAAGAGCAGGAACGATGGTGATTGAATCGTTTGTAGTTGATGTTCCTCAAGGTAACACAAAGGATGAGACTTGCTACTTTGTTGAAGCACTTATCAGATGTAATCTCAAGTCACTAGCAGATGTTTCTGAAAGATTGGCTTCTCAGGACATTACTCAGTGA
Protein Sequence
- >AT1G01360.1 MMDGVEGGTAMYGGLETVQYVRTHHQHLCRENQCTSALVKHIKAPLHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIGSLREVNVKSGLPATTSTERLELLDDEEHILGIKIIGGDHRLKNYSSILTVHPEIIEGRAGTMVIESFVVDVPQGNTKDETCYFVEALIRCNLKSLADVSERLASQDITQ