Gene Details:
- Gene ID: AT1G01720
- Gene Symbol: ANAC002, ANAC2, ATAF1
- Gene Name: Arabidopsis NAC domain containing protein 2
- Description: NAC (No Apical Meristem) domain transcriptional regulator superfamily protein;(source:Araport11)
- TAIR Accession: locus:2198225
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0000013 — cauline leaf — hoja caulinar (Spanish, exact), 茎生葉、茎葉 (Japanese, exact)
- PO:0000230 — inflorescence meristem — meristema de la inflorescencia (Spanish, exact), 花序分裂組織 (Japanese, exact)
- PO:0009010 — seed — semilla (Spanish, exact), 種子 (Japanese, exact), pyrene (narrow), diaspore (broad)
- PO:0009030 — carpel — carpelo (Spanish, exact), 心皮 (Japanese, exact), Poaceae carpel (narrow), Zea carpel (narrow), pistil (broad)
- PO:0009032 — petal — pétalo (Spanish, exact), 花弁 (Japanese, exact)
- PO:0009047 — stem — caña (Spanish, exact), culm (exact), eje primario (Spanish, exact), primary axis (exact), primary stem (exact), tallo (Spanish, exact), tronco (Spanish, exact), 茎 (Japanese, exact), bole (narrow), cane (narrow), caudex (narrow), caudices (narrow), core (narrow), primocane (narrow), scape (narrow), stalk (narrow), trunk (narrow)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0025195 — pollen tube cell — célula del tubo polínico (Spanish, exact), 花粉管細胞 (Japanese, exact)
- PO:0000293 — guard cell — célula guardiana (Spanish, exact), occlusive cell (exact), 孔辺細胞 (Japanese, exact)
Gene Ontology:
- GO:0006355 — involved in — regulation of DNA-templated transcription
- GO:0009788 — acts upstream of or within — negative regulation of abscisic acid-activated signaling pathway
- GO:0000976 — enables — transcription cis-regulatory region binding
- GO:0071456 — acts upstream of or within — cellular response to hypoxia
- GO:0003700 — enables — DNA-binding transcription factor activity
- GO:0005634 — located in — nucleus
- GO:0009611 — acts upstream of or within — response to wounding
Germplasm Phenotype:
- SALK_057618 — higher survival rate and fresh mass after heat shock, showing thermomemory.
Function-related keywords:
- cauline leaf , inflorescence meristem , seed , carpel , petal , stem , pollen , pollen tube cell , guard cell
Literature:
- Diurnal Regulation of Plant Epidermal Wax Synthesis through Antagonistic Roles of the Transcription Factors SPL9 and DEWAX. DOI: 10.1105/tpc.19.00233 ; PMID: 31484683
- GDSL lipase occluded stomatal pore 1 is required for wax biosynthesis and stomatal cuticular ledge formation. DOI: 10.1111/nph.16741 ; PMID: 32542680
- AP2/DREB Transcription Factor RAP2.4 Activates Cuticular Wax Biosynthesis in Arabidopsis Leaves Under Drought. DOI: 10.3389/fpls.2020.00895 ; PMID: 32719695
- NA DOI: NA ; PMID: 33831161
- Acyl-CoA desaturase ADS4.2 is involved in the formation of characteristic wax alkenes in young Arabidopsis leaves. DOI: 10.1093/plphys/kiab182 ; PMID: 33890667
- Two Arabidopsis MYB-SHAQKYF transcription repressors regulate leaf wax biosynthesis via transcriptional suppression on DEWAX. DOI: 10.1111/nph.18498 ; PMID: 36110041
- Identification of genes of the plant-specific transcription-factor families cooperatively regulated by ethylene and jasmonate in Arabidopsis thaliana. DOI: 10.1007/s10265-006-0287-x ; PMID: 16820983
- Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings. DOI: 10.1111/j.1365-313X.2006.02979.x ; PMID: 17217462
- The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth. DOI: 10.1105/tpc.106.041319 ; PMID: 17329565
- A membrane-associated NAC domain transcription factor XVP interacts with TDIF co-receptor and regulates vascular meristem activity. DOI: 10.1111/nph.16289 ; PMID: 31660587
- A novel NAC domain transcription factor XVP controls the balance of xylem formation and cambial cell divisions. DOI: 10.1111/nph.16400 ; PMID: 31960459
- Chloroplast Protein Tic55 Involved in Dark-Induced Senescence through AtbHLH/AtWRKY-ANAC003 Controlling Pathway of Arabidopsis thaliana. DOI: 10.3390/genes13020308 ; PMID: 35205352
- Transcription factor ANAC004 enhances Cd tolerance in Arabidopsis thaliana by regulating cell wall fixation, translocation and vacuolar detoxification of Cd, ABA accumulation and antioxidant capacity. DOI: 10.1016/j.jhazmat.2022.129121 ; PMID: 35580499
- The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl. DOI: 10.1104/pp.105.060202 ; PMID: 15923329
- ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana. DOI: 10.1111/j.1365-313X.2007.03109.x ; PMID: 17565617
- ANAC005 is a membrane-associated transcription factor and regulates vascular development in Arabidopsis. DOI: 10.1111/jipb.12379 ; PMID: 26178734
- A subgroup of plant aquaporins facilitate the bi-directional diffusion of As(OH)3 and Sb(OH)3 across membranes. DOI: 10.1186/1741-7007-6-26 ; PMID: 18544156
- Functional analysis of the two Arabidopsis homologues of Toc34, a component of the chloroplast protein import apparatus. DOI: 10.1046/j.1365-313x.2000.00849.x ; PMID: 10998188
- An Arabidopsis mutant defective in the plastid general protein import apparatus. DOI: 10.1126/science.282.5386.100 ; PMID: 9756470
- Chloroplast protein translocon components atToc159 and atToc33 are not essential for chloroplast biogenesis in guard cells and root cells. DOI: 10.1104/pp.127.1.90 ; PMID: 11553737
- The targeting of the atToc159 preprotein receptor to the chloroplast outer membrane is mediated by its GTPase domain and is regulated by GTP. DOI: 10.1083/jcb.200208017 ; PMID: 12473690
- Leaf-specific upregulation of chloroplast translocon genes by a CCT motif-containing protein, CIA 2. DOI: 10.1105/tpc.010148 ; PMID: 11549763
- Two Toc34 homologues with different properties. DOI: 10.1021/bi034001q ; PMID: 12741849
- Unusual nucleotide-binding properties of the chloroplast protein import receptor, atToc33. DOI: 10.1016/s0014-5793(03)00478-2 ; PMID: 12782294
- Dimerization of Toc-GTPases at the chloroplast protein import machinery. DOI: 10.1074/jbc.M305946200 ; PMID: 12869544
- The Arabidopsis ppi1 mutant is specifically defective in the expression, chloroplast import, and accumulation of photosynthetic proteins. DOI: 10.1105/tpc.012955 ; PMID: 12897258
- The roles of toc34 and toc75 in targeting the toc159 preprotein receptor to chloroplasts. DOI: 10.1074/jbc.M307873200 ; PMID: 12951325
- An outer envelope membrane component of the plastid protein import apparatus plays an essential role in Arabidopsis. DOI: 10.1111/j.1365-313X.2004.02024.x ; PMID: 15053763
- AtToc90, a new GTP-binding component of the Arabidopsis chloroplast protein import machinery. DOI: 10.1023/B:PLAN.0000036374.92546.51 ; PMID: 15284497
- Functional specialization amongst the Arabidopsis Toc159 family of chloroplast protein import receptors. DOI: 10.1105/tpc.104.023309 ; PMID: 15273297
- A role of Toc33 in the protochlorophyllide-dependent plastid import pathway of NADPH:protochlorophyllide oxidoreductase (POR) A. DOI: 10.1111/j.1365-313X.2005.02353.x ; PMID: 15773849
- and organ-specific import routes for the NADPH-protochlorophyllide oxidoreductases A and B in plastids of Arabidopsis seedlings. DOI: 10.1111/j.1365-313X.2005.02374.x ; PMID: 15842619
- Targeting of an abundant cytosolic form of the protein import receptor at Toc159 to the outer chloroplast membrane. DOI: 10.1083/jcb.200104022 ; PMID: 11470820
- In vivo assessment of the significance of phosphorylation of the Arabidopsis chloroplast protein import receptor, atToc33. DOI: 10.1016/j.febslet.2005.12.055 ; PMID: 16412428
- In vitro comparative kinetic analysis of the chloroplast Toc GTPases. DOI: 10.1074/jbc.M609491200 ; PMID: 17261588
- Dimerization is important for the GTPase activity of chloroplast translocon components atToc33 and psToc159. DOI: 10.1074/jbc.M608385200 ; PMID: 17337454
- Phospho-mimicry mutant of atToc33 affects early development of Arabidopsis thaliana. DOI: 10.1016/j.febslet.2007.11.071 ; PMID: 18054337
- AKR2A-mediated import of chloroplast outer membrane proteins is essential for chloroplast biogenesis. DOI: 10.1038/ncb1683 ; PMID: 18193034
- The GTPase cycle of the chloroplast import receptors Toc33/Toc34: implications from monomeric and dimeric structures. DOI: 10.1016/j.str.2008.01.008 ; PMID: 18400179
- On the significance of Toc-GTPase homodimers. DOI: 10.1074/jbc.M710576200 ; PMID: 18541539
- In vivo interaction between atToc33 and atToc159 GTP-binding domains demonstrated in a plant split-ubiquitin system. DOI: 10.1093/jxb/ern283 ; PMID: 19010773
- Targeting of nucleus-encoded proteins to chloroplasts in plants. DOI: 10.1111/j.1469-8137.2008.02452.x ; PMID: 19086173
- CIA2 coordinately up-regulates protein import and synthesis in leaf chloroplasts. DOI: 10.1104/pp.109.137240 ; PMID: 19386807
- pH sensitivity of the GTPase Toc33 as a regulatory circuit for protein translocation into chloroplasts. DOI: 10.1093/pcp/pcn171 ; PMID: 19001421
- Interaction of actin and the chloroplast protein import apparatus. DOI: 10.1074/jbc.M109.012831 ; PMID: 19435889
- The acidic A-domain of Arabidopsis TOC159 occurs as a hyperphosphorylated protein. DOI: 10.1104/pp.110.158048 ; PMID: 20457805
- Nucleotide binding and dimerization at the chloroplast pre-protein import receptor, atToc33, are not essential in vivo but do increase import efficiency. DOI: 10.1111/j.1365-313X.2010.04242.x ; PMID: 20444229
- Identification of nuclear genes encoding chloroplast-localized proteins required for embryo development in Arabidopsis. DOI: 10.1104/pp.110.168120 ; PMID: 21139083
- Species specific amino acid sequence-protein local structure relationships: An analysis in the light of a structural alphabet. DOI: 10.1016/j.jtbi.2011.01.047 ; PMID: 21333657
- OEP61 is a chaperone receptor at the plastid outer envelope. DOI: 10.1042/BJ20110448 ; PMID: 21612577
- Toc33 and Toc64-III cooperate in precursor protein import into the chloroplasts of Arabidopsis thaliana. DOI: 10.1111/pce.12030 ; PMID: 23131143
- Rapid identification of angulata leaf mutations using next-generation sequencing. DOI: 10.1007/s00425-014-2137-8 ; PMID: 25102851
- E3 ubiquitin ligase SP1 regulates peroxisome biogenesis in Arabidopsis. DOI: 10.1073/pnas.1613530113 ; PMID: 27799549
- The POTRA domains of Toc75 exhibit chaperone-like function to facilitate import into chloroplasts. DOI: 10.1073/pnas.1621179114 ; PMID: 28559331
Sequence:
cDNA Sequence
- >AT1G01720.1 ACAAAAAAAAAATATAAACGGAGGAACTAGGCAGTGGGACCGGAGATCCACCGACCGGAAACGAAGAATCCATAGTAAGATAGAGCCCAGGGGTTCGGTCGTATCGGACCGGTCGGATTTGGATTCTAACGACAAGTGAGTGGACCCCCAGAAACGACAGACGTAAGCAATGACAACATCAAACTCATCGCCACGTCAGCAACGGAGTTCTACTTGCGAAACGTGTCCCGGCAGCGTCATCCACCCACGTGTGTTCTAGAAGCTCTTCTCCTCCTCCGTATCTCGACACGTGTCCACTCCCTCTCCTTATATAATTGACTTTTCTCTCATTCTTTCCAAGTTTCAAAAACGCCAAGTTTCAGAGGTAGAGAGAGAGATACTACAATTGATTAGGATAGGATCAGGATCATCCTCAACAACCTCCTCCTAATTCCTCCTCCATTCATAGTAACAATAATATTAAGAAAGAGGGTAAACTATGTCAGAATTATTACAGTTGCCTCCAGGTTTCCGATTTCACCCTACCGATGAAGAGCTTGTCATGCACTATCTCTGCCGCAAATGTGCCTCTCAGTCCATCGCCGTTCCGATCATCGCTGAGATCGATCTCTACAAATACGATCCATGGGAGCTTCCTGGTTTAGCCTTGTATGGTGAGAAGGAATGGTACTTCTTCTCTCCCAGGGACAGAAAATATCCCAACGGTTCGCGTCCTAACCGGTCCGCTGGTTCTGGTTACTGGAAAGCTACCGGAGCTGATAAACCGATCGGACTACCTAAACCGGTCGGAATTAAGAAAGCTCTTGTTTTCTACGCCGGCAAAGCTCCAAAGGGAGAGAAAACCAATTGGATCATGCACGAGTACCGTCTCGCCGACGTTGACCGGTCCGTTCGCAAGAAGAAGAATAGTCTCAGGCTGGATGATTGGGTTCTCTGCCGGATTTACAACAAAAAAGGAGCTACCGAGAGGCGGGGACCACCGCCTCCGGTTGTTTACGGCGACGAAATCATGGAGGAGAAGCCGAAGGTGACGGAGATGGTTATGCCTCCGCCGCCGCAACAGACAAGTGAGTTCGCGTATTTCGACACGTCGGATTCGGTGCCGAAGCTGCATACTACGGATTCGAGTTGCTCGGAGCAGGTGGTGTCGCCGGAGTTCACGAGCGAGGTTCAGAGCGAGCCCAAGTGGAAAGATTGGTCGGCCGTAAGTAATGACAATAACAATACCCTTGATTTTGGGTTTAATTACATTGATGCCACCGTGGATAACGCGTTTGGAGGAGGAGGGAGTAGTAATCAGATGTTTCCGCTACAGGATATGTTCATGTACATGCAGAAGCCTTACTAGAAGGGAATTCCTTTCCTGCCGCCGAAACGCAACGCAAAACGACCCTCGTTTTTGCGTTTATGGCAACACGAGACCGTTTTATATGGTCAATGAGTGTGCCGATTCGGCCATTAGATTTCTGTTCAGTCTTCGTTTATTCTATAGACCGTCCGATTTCAGATCATCCCTAATCGGACGGTGGTCGTTGGATGTATCAGTAGTGTATTACTGTGTTAGGTAGAAGAAAATCCACTTGTTCTTAAATTGGCATAAAAGTCAGAAGCTAATATTTATATGTGCCGCAATCAATTTAATATTTTCTGTCT
CDS Sequence
- >AT1G01720.1 ATGTCAGAATTATTACAGTTGCCTCCAGGTTTCCGATTTCACCCTACCGATGAAGAGCTTGTCATGCACTATCTCTGCCGCAAATGTGCCTCTCAGTCCATCGCCGTTCCGATCATCGCTGAGATCGATCTCTACAAATACGATCCATGGGAGCTTCCTGGTTTAGCCTTGTATGGTGAGAAGGAATGGTACTTCTTCTCTCCCAGGGACAGAAAATATCCCAACGGTTCGCGTCCTAACCGGTCCGCTGGTTCTGGTTACTGGAAAGCTACCGGAGCTGATAAACCGATCGGACTACCTAAACCGGTCGGAATTAAGAAAGCTCTTGTTTTCTACGCCGGCAAAGCTCCAAAGGGAGAGAAAACCAATTGGATCATGCACGAGTACCGTCTCGCCGACGTTGACCGGTCCGTTCGCAAGAAGAAGAATAGTCTCAGGCTGGATGATTGGGTTCTCTGCCGGATTTACAACAAAAAAGGAGCTACCGAGAGGCGGGGACCACCGCCTCCGGTTGTTTACGGCGACGAAATCATGGAGGAGAAGCCGAAGGTGACGGAGATGGTTATGCCTCCGCCGCCGCAACAGACAAGTGAGTTCGCGTATTTCGACACGTCGGATTCGGTGCCGAAGCTGCATACTACGGATTCGAGTTGCTCGGAGCAGGTGGTGTCGCCGGAGTTCACGAGCGAGGTTCAGAGCGAGCCCAAGTGGAAAGATTGGTCGGCCGTAAGTAATGACAATAACAATACCCTTGATTTTGGGTTTAATTACATTGATGCCACCGTGGATAACGCGTTTGGAGGAGGAGGGAGTAGTAATCAGATGTTTCCGCTACAGGATATGTTCATGTACATGCAGAAGCCTTACTAG
Protein Sequence
- >AT1G01720.1 MSELLQLPPGFRFHPTDEELVMHYLCRKCASQSIAVPIIAEIDLYKYDPWELPGLALYGEKEWYFFSPRDRKYPNGSRPNRSAGSGYWKATGADKPIGLPKPVGIKKALVFYAGKAPKGEKTNWIMHEYRLADVDRSVRKKKNSLRLDDWVLCRIYNKKGATERRGPPPPVVYGDEIMEEKPKVTEMVMPPPPQQTSEFAYFDTSDSVPKLHTTDSSCSEQVVSPEFTSEVQSEPKWKDWSAVSNDNNNTLDFGFNYIDATVDNAFGGGGSSNQMFPLQDMFMYMQKPY