Gene Details:
- Gene ID: AT2G27250
- Gene Symbol: AtCLV3, CLV3
- Gene Name: CLAVATA3
- Description: CLAVATA3;(source:Araport11)
- TAIR Accession: locus:2005502
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0000229 — flower meristem — floral meristem (exact), mersitema floral (Spanish, exact), 花芽分裂組織 (Japanese, exact), floral apical meristem (related), Poaceae floret meristem (narrow), ear floret meristem (narrow), floret meristem (narrow), tassel floret meristem (narrow)
- PO:0020144 — apical meristem — AM (exact), meristema apical (Spanish, exact), 頂端分裂組織 (Japanese, exact), primary meristem (related), promeristem (broad)
- PO:0000224 — central zone — zona central (Spanish, exact), 中央帯 (Japanese, exact), central initiation zone (related)
Gene Ontology:
- GO:0033612 — enables — receptor serine/threonine kinase binding
- GO:0045168 — involved in — cell-cell signaling involved in cell fate commitment
- GO:0005576 — located in — extracellular region
- GO:0005515 — enables — protein binding
- GO:0005739 — located in — mitochondrion
- GO:0048507 — acts upstream of or within — meristem development
- GO:0009934 — acts upstream of or within — regulation of meristem structural organization
- GO:0010074 — acts upstream of or within — maintenance of meristem identity
- GO:0045087 — acts upstream of or within — innate immune response
- GO:0045168 — acts upstream of or within — cell-cell signaling involved in cell fate commitment
- GO:0030154 — acts upstream of or within — cell differentiation
- GO:0016043 — acts upstream of or within — cellular component organization
- GO:0005102 — enables — signaling receptor binding
- GO:0007165 — acts upstream of or within — signal transduction
- GO:0048046 — located in — apoplast
Function-related keywords:
Literature:
- Dependence of stem cell fate in Arabidopsis on a feedback loop regulated by CLV3 activity. DOI: 10.1126/science.289.5479.617 ; PMID: 10915624
- CLAVATA3, a multimeric ligand for the CLAVATA1 receptor-kinase. DOI: 10.1126/science.289.5479.613 ; PMID: 10915623
- Specific and heritable genetic interference by double-stranded RNA in Arabidopsis thaliana. DOI: 10.1073/pnas.060034297 ; PMID: 10781109
- The stem cell population of Arabidopsis shoot meristems in maintained by a regulatory loop between the CLAVATA and WUSCHEL genes. DOI: 10.1016/s0092-8674(00)80700-x ; PMID: 10761929
- POLTERGEIST functions to regulate meristem development downstream of the CLAVATA loci. DOI: 10.1242/dev.127.8.1661 ; PMID: 10725242
- Signaling of cell fate decisions by CLAVATA3 in Arabidopsis shoot meristems. DOI: 10.1126/science.283.5409.1911 ; PMID: 10082464
- The CLAVATA1 receptor-like kinase requires CLAVATA3 for its assembly into a signaling complex that includes KAPP and a Rho-related protein. DOI: 10.1105/tpc.11.3.393 ; PMID: 10072399
- CLAVATA2, a regulator of meristem and organ development in Arabidopsis. DOI: 10.1242/dev.125.19.3843 ; PMID: 9729492
- Cellular parameters of the shoot apical meristem in Arabidopsis. DOI: 10.1105/tpc.10.8.1375 ; PMID: 9707536
- The WIGGUM gene is required for proper regulation of floral meristem size in Arabidopsis. DOI: 10.1242/dev.125.14.2545 ; PMID: 9636070
- A genetic screen for modifiers of UFO meristem activity identifies three novel FUSED FLORAL ORGANS genes required for early flower development in Arabidopsis. DOI: 10.1093/genetics/149.2.579 ; PMID: 9611175
- MGOUN1 and MGOUN2: two genes required for primordium initiation at the shoot apical and floral meristems in Arabidopsis thaliana. DOI: 10.1242/dev.125.7.1253 ; PMID: 9477323
- FON1, an Arabidopsis gene that terminates floral meristem activity and controls flower organ number. DOI: 10.1105/tpc.9.2.115 ; PMID: 9061945
- Genetic control of shoot and flower meristem behavior. DOI: 10.1016/s0955-0674(96)80089-5 ; PMID: 8939670
- The CLAVATA and SHOOT MERISTEMLESS loci competitively regulate meristem activity in Arabidopsis. DOI: 10.1242/dev.122.5.1567 ; PMID: 8625843
- Correlative controls of senescence and plant death in Arabidopsis thaliana (Brassicaceae). DOI: 10.1093/jexbot/52.364.2151 ; PMID: 11604454
- SHEPHERD is the Arabidopsis GRP94 responsible for the formation of functional CLAVATA proteins. DOI: 10.1093/emboj/21.5.898 ; PMID: 11867518
- Regulation of CLV3 expression by two homeobox genes in Arabidopsis. DOI: 10.1104/pp.001867 ; PMID: 12068101
- CLV3 is localized to the extracellular space, where it activates the Arabidopsis CLAVATA stem cell signaling pathway. DOI: 10.1105/tpc.002196 ; PMID: 12034890
- A large family of genes that share homology with CLAVATA3. DOI: 10.1104/pp.126.3.939 ; PMID: 11457943
- HAR1 mediates systemic regulation of symbiotic organ development. DOI: 10.1038/nature01231 ; PMID: 12442172
- The Arabidopsis CLV3-like (CLE) genes are expressed in diverse tissues and encode secreted proteins. DOI: 10.1023/a:1022038932376 ; PMID: 12602871
- The DORNROSCHEN/ENHANCER OF SHOOT REGENERATION1 gene of Arabidopsis acts in the control of meristem ccll fate and lateral organ development. DOI: 10.1105/tpc.009480 ; PMID: 12615942
- Loss of CLE40, a protein functionally equivalent to the stem cell restricting signal CLV3, enhances root waving in Arabidopsis. DOI: 10.1007/s00427-003-0329-5 ; PMID: 12743822
- Stem cell homeostasis in the Arabidopsis shoot meristem is regulated by intercellular movement of CLAVATA3 and its sequestration by CLAVATA1. DOI: 10.1242/dev.00525 ; PMID: 12783788
- Leucine-rich repeat receptor kinases in plants: structure, function, and signal transduction pathways. DOI: 10.1016/S0074-7696(04)34001-5 ; PMID: 15066372
- HANABA TARANU is a GATA transcription factor that regulates shoot apical meristem and flower development in Arabidopsis. DOI: 10.1105/tpc.104.024869 ; PMID: 15367721
- Enlarged meristems and delayed growth in plp mutants result from lack of CaaX prenyltransferases. DOI: 10.1073/pnas.0402385101 ; PMID: 15128936
- Photoperiod regulates flower meristem development in Arabidopsis thaliana. DOI: 10.1534/genetics.104.033357 ; PMID: 15489527
- CORONA, a member of the class III homeodomain leucine zipper gene family in Arabidopsis, regulates stem cell specification and organogenesis. DOI: 10.1105/tpc.104.026179 ; PMID: 15705957
- Peptide signals and their receptors in higher plants. DOI: 10.1016/s1360-1385(01)02148-3 ; PMID: 11738382
- Modeling the organization of the WUSCHEL expression domain in the shoot apical meristem. DOI: 10.1093/bioinformatics/bti1036 ; PMID: 15961462
- The 14-amino acid CLV3, CLE19, and CLE40 peptides trigger consumption of the root meristem in Arabidopsis through a CLAVATA2-dependent pathway. DOI: 10.1105/tpc.105.034009 ; PMID: 16055633
- Stem-cell homeostasis and growth dynamics can be uncoupled in the Arabidopsis shoot apex. DOI: 10.1126/science.1116261 ; PMID: 16210497
- A distinct type of cyclin D, CYCD4;2, involved in the activation of cell division in Arabidopsis. DOI: 10.1007/s00299-005-0075-4 ; PMID: 16408177
- Evidence for functional conservation, sufficiency, and proteolytic processing of the CLAVATA3 CLE domain. DOI: 10.1104/pp.105.072678 ; PMID: 16407446
- APETALA2 regulates the stem cell niche in the Arabidopsis shoot meristem. DOI: 10.1105/tpc.105.038398 ; PMID: 16387832
- Gain-of-function phenotypes of many CLAVATA3/ESR genes, including four new family members, correlate with tandem variations in the conserved CLAVATA3/ESR domain. DOI: 10.1104/pp.105.075515 ; PMID: 16489133
- Dynamic and compensatory responses of Arabidopsis shoot and floral meristems to CLV3 signaling. DOI: 10.1105/tpc.105.040444 ; PMID: 16603652
- The CLAVATA3/ESR motif of CLAVATA3 is functionally independent from the nonconserved flanking sequences. DOI: 10.1104/pp.106.080671 ; PMID: 16751438
- A plant peptide encoded by CLV3 identified by in situ MALDI-TOF MS analysis. DOI: 10.1126/science.1128439 ; PMID: 16902141
- Dodeca-CLE peptides as suppressors of plant stem cell differentiation. DOI: 10.1126/science.1128436 ; PMID: 16902140
- Ligand mimicry? Plant-parasitic nematode polypeptide with similarity to CLAVATA3. DOI: 10.1016/S1360-1385(03)00003-7 ; PMID: 12597870
- Conservation and diversification of meristem maintenance mechanism in Oryza sativa: Function of the FLORAL ORGAN NUMBER2 gene. DOI: 10.1093/pcp/pcl025 ; PMID: 17056620
- Developmental characterization of the fasciated locus and mapping of Arabidopsis candidate genes involved in the control of floral meristem size and carpel number in tomato. DOI: 10.1139/g06-059 ; PMID: 17036074
- The floral organ number4 gene encoding a putative ortholog of Arabidopsis CLAVATA3 regulates apical meristem size in rice. DOI: 10.1104/pp.106.086736 ; PMID: 17012407
- CLE peptide ligands and their roles in establishing meristems. DOI: 10.1016/j.pbi.2006.11.003 ; PMID: 17129751
- CLV3/ESR-related (CLE) peptides as intercellular signaling molecules in plants. DOI: 10.1002/tcr.20091 ; PMID: 17304552
- Mutations in the TORNADO2 gene affect cellular decisions in the peripheral zone of the shoot apical meristem of Arabidopsis thaliana. DOI: 10.1007/s11103-006-9105-z ; PMID: 17351828
- Divergent functions of VTI12 and VTI11 in trafficking to storage and lytic vacuoles in Arabidopsis. DOI: 10.1073/pnas.0611147104 ; PMID: 17360696
- SHA1, a novel RING finger protein, functions in shoot apical meristem maintenance in Arabidopsis. DOI: 10.1111/j.1365-313X.2007.03062.x ; PMID: 17461786
- Pattern formation during de novo assembly of the Arabidopsis shoot meristem. DOI: 10.1242/dev.010298 ; PMID: 17827180
- The CLE family of plant polypeptide signaling molecules. DOI: 10.1007/s00018-007-7411-5 ; PMID: 18034320
- Gain-of-function phenotypes of chemically synthetic CLAVATA3/ESR-related (CLE) peptides in Arabidopsis thaliana and Oryza sativa. DOI: 10.1093/pcp/pcm154 ; PMID: 17991631
- Arabidopsis CLV3 peptide directly binds CLV1 ectodomain. DOI: 10.1126/science.1150083 ; PMID: 18202283
- The receptor kinase CORYNE of Arabidopsis transmits the stem cell-limiting signal CLAVATA3 independently of CLAVATA1. DOI: 10.1105/tpc.107.057547 ; PMID: 18381924
- Signals derived from YABBY gene activities in organ primordia regulate growth and partitioning of Arabidopsis shoot apical meristems. DOI: 10.1105/tpc.107.057877 ; PMID: 18469164
- The EPIP peptide of INFLORESCENCE DEFICIENT IN ABSCISSION is sufficient to induce abscission in arabidopsis through the receptor-like kinases HAESA and HAESA-LIKE2. DOI: 10.1105/tpc.108.059139 ; PMID: 18660431
- Vascular signalling mediated by ZWILLE potentiates WUSCHEL function during shoot meristem stem cell development in the Arabidopsis embryo. DOI: 10.1242/dev.023648 ; PMID: 18653559
- Functional diversification of CLAVATA3-related CLE proteins in meristem maintenance in rice. DOI: 10.1105/tpc.107.057257 ; PMID: 18676878
- BAM receptors regulate stem cell specification and organ development through complex interactions with CLAVATA signaling. DOI: 10.1534/genetics.108.091108 ; PMID: 18780746
- A quantitative and dynamic model for plant stem cell regulation. DOI: 10.1371/journal.pone.0003553 ; PMID: 18958283
- The receptor-like kinase SOL2 mediates CLE signaling in Arabidopsis. DOI: 10.1093/pcp/pcn148 ; PMID: 18854335
- Dual assay for MCLV3 activity reveals structure-activity relationship of CLE peptides. DOI: 10.1016/j.bbrc.2008.09.139 ; PMID: 18848920
- Plant CLE peptides from two distinct functional classes synergistically induce division of vascular cells. DOI: 10.1073/pnas.0809395105 ; PMID: 19011104
- MERISTEM-DEFECTIVE, an RS domain protein, is required for the correct meristem patterning and function in Arabidopsis. DOI: 10.1111/j.1365-313X.2008.03738.x ; PMID: 19000164
- Pluripotency of Arabidopsis xylem pericycle underlies shoot regeneration from root and hypocotyl explants grown in vitro. DOI: 10.1111/j.1365-313X.2008.03715.x ; PMID: 18980654
- Influence of clavata3-2 mutation on early flower development in Arabidopsis thaliana: quantitative analysis of changing geometry. DOI: 10.1093/jxb/ern312 ; PMID: 19088334
- WUSCHEL regulates cell differentiation during anther development. DOI: 10.1016/j.ydbio.2006.09.013 ; PMID: 17027956
- Multiple MONOPTEROS-dependent pathways are involved in leaf initiation. DOI: 10.1104/pp.108.119396 ; PMID: 18685044
- A signaling module controlling the stem cell niche in Arabidopsis root meristems. DOI: 10.1016/j.cub.2009.03.060 ; PMID: 19398337
- Enhanced AGAMOUS expression in the centre of the Arabidopsis flower causes ectopic expression over its outer expression boundaries. DOI: 10.1007/s00425-009-0966-7 ; PMID: 19554348
- A glycopeptide regulating stem cell fate in Arabidopsis thaliana. DOI: 10.1038/nchembio.182 ; PMID: 19525968
- The association of homeobox gene expression with stem cell formation and morphogenesis in cultured Medicago truncatula. DOI: 10.1007/s00425-009-0988-1 ; PMID: 19639337
- Overexpression of an Arabidopsis gene encoding a subtilase (AtSBT5.4) produces a clavata-like phenotype. DOI: 10.1007/s00425-009-0976-5 ; PMID: 19588163
- Structural and functional diversity of CLAVATA3/ESR (CLE)-like genes from the potato cyst nematode Globodera rostochiensis. DOI: 10.1094/MPMI-22-9-1128 ; PMID: 19656047
- The Shoot Apical Meristem Size Regulated by FON4 in Rice. DOI: 10.4161/psb.2.2.3641 ; PMID: 19704753
- Analysis of interactions among the CLAVATA3 receptors reveals a direct interaction between CLAVATA2 and CORYNE in Arabidopsis. DOI: 10.1111/j.1365-313X.2009.04049.x ; PMID: 19843317
- FON2 SPARE1 redundantly regulates floral meristem maintenance with FLORAL ORGAN NUMBER2 in rice. DOI: 10.1371/journal.pgen.1000693 ; PMID: 19834537
- Developmental consequences of the tumorous shoot development1 mutation, a novel allele of the cellulose-synthesizing KORRIGAN1 gene. DOI: 10.1007/s11103-009-9546-2 ; PMID: 19826767
- Is the Arabidopsis root niche protected by sequestration of the CLE40 signal by its putative receptor ACR4? DOI: 10.4161/psb.4.7.8970 ; PMID: 19820344
- Evolution of CLE signaling: origins of the CLV1 and SOL2/CRN receptor diversity. DOI: 10.4161/psb.4.6.8391 ; PMID: 19816140
- Stem cell signaling in Arabidopsis requires CRN to localize CLV2 to the plasma membrane. DOI: 10.1104/pp.109.149930 ; PMID: 19933383
- Role of A-type ARABIDOPSIS RESPONSE REGULATORS in meristem maintenance and regeneration. DOI: 10.1016/j.ejcb.2009.11.016 ; PMID: 20018401
- CLE peptide signaling during plant development. DOI: 10.1007/s00709-009-0095-y ; PMID: 20016993
- Multiple receptor complexes assembled for transmitting CLV3 signaling in Arabidopsis. DOI: 10.4161/psb.5.3.10790 ; PMID: 20220313
- Identification of novel markers for stem-cell niche of Arabidopsis shoot apex. DOI: 10.1016/j.gep.2010.05.004 ; PMID: 20580859
- Arabinosylated glycopeptide hormones: new insights into CLAVATA3 structure. DOI: 10.1016/j.pbi.2010.05.008 ; PMID: 20580598
- Cytokinin and auxin regulates WUS induction and inflorescence regeneration in vitro in Arabidopsis. DOI: 10.1007/s00299-010-0879-8 ; PMID: 20514542
- A parasitism gene from a plant-parasitic nematode with function similar to CLAVATA3/ESR (CLE) of Arabidopsis thaliana. DOI: 10.1111/j.1364-3703.2005.00270.x ; PMID: 20565649
- CLAVATA2 forms a distinct CLE-binding receptor complex regulating Arabidopsis stem cell specification. DOI: 10.1111/j.1365-313X.2010.04295.x ; PMID: 20626648
- CLE peptides can negatively regulate protoxylem vessel formation via cytokinin signaling. DOI: 10.1093/pcp/pcq129 ; PMID: 20802224
- Convergence of the 26S proteasome and the REVOLUTA pathways in regulating inflorescence and floral meristem functions in Arabidopsis. DOI: 10.1093/jxb/erq277 ; PMID: 20797995
- The cysteine pairs in CLV2 are not necessary for sensing the CLV3 peptide in shoot and root meristems. DOI: 10.1111/j.1744-7909.2010.00978.x ; PMID: 20738721
- CLE14/CLE20 peptides may interact with CLAVATA2/CORYNE receptor-like kinases to irreversibly inhibit cell division in the root meristem of Arabidopsis. DOI: 10.1007/s00425-010-1236-4 ; PMID: 20697738
- RPK2 is an essential receptor-like kinase that transmits the CLV3 signal in Arabidopsis. DOI: 10.1242/dev.048199 ; PMID: 20978082
- Mitogen-activated protein kinase regulated by the CLAVATA receptors contributes to shoot apical meristem homeostasis. DOI: 10.1093/pcp/pcq157 ; PMID: 20965998
- Analogs of the CLV3 peptide: synthesis and structure-activity relationships focused on proline residues. DOI: 10.1093/pcp/pcq146 ; PMID: 20926417
- Membrane distributions of two ligand-binding receptor complexes in the CLAVATA pathway. DOI: 10.1111/j.1365-313X.2010.04295 ; PMID: 21051944
- The FANTASTIC FOUR proteins influence shoot meristem size in Arabidopsis thaliana. DOI: 10.1186/1471-2229-10-285 ; PMID: 21176196
- Identification of target ligands of CORYNE in Arabidopsis by phage display library. DOI: 10.1111/j.1744-7909.2010.01028.x ; PMID: 21214859
- CLE genes may act in a variety of tissues/cells and involve other signaling cascades in addition to CLV3-WUS-like pathways. DOI: 10.4161/psb.6.1.14186 ; PMID: 21270538
- Nematode CLE signaling in Arabidopsis requires CLAVATA2 and CORYNE. DOI: 10.1111/j.1365-313X.2010.04433.x ; PMID: 21265896
- CLE polypeptide signaling gene expression in Arabidopsis embryos. DOI: 10.4161/psb.6.3.14553 ; PMID: 21278487
- Plant stem cell signaling involves ligand-dependent trafficking of the CLAVATA1 receptor kinase. DOI: 10.1016/j.cub.2011.01.039 ; PMID: 21333538
- Stem-cell-triggered immunity through CLV3p-FLS2 signalling. DOI: 10.1038/nature09958 ; PMID: 21499263
- DNA uptake by Arabidopsis induces changes in the expression of CLE peptides which control root morphology. DOI: 10.4161/psb.5.9.12477 ; PMID: 21490419
- Over-expression of WOX1 leads to defects in meristem development and polyamine homeostasis in Arabidopsis. DOI: 10.1111/j.1744-7909.2011.01054.x ; PMID: 21658178
- Expression and functional analysis of a CLV3-like gene in the model legume Lotus japonicus. DOI: 10.1093/pcp/pcr071 ; PMID: 21652543
- Nucleostemin-like 1 is required for embryogenesis and leaf development in Arabidopsis. DOI: 10.1007/s11103-011-9840-7 ; PMID: 22058024
- Glycosides of hydroxyproline: some recent, unusual discoveries. DOI: 10.1093/glycob/cwr188 ; PMID: 22190471
- WUSCHEL protein movement mediates stem cell homeostasis in the Arabidopsis shoot apex. DOI: 10.1101/gad.17258511 ; PMID: 21979915
- Contributions of individual amino acid residues to the endogenous CLV3 function in shoot apical meristem maintenance in Arabidopsis. DOI: 10.1093/mp/ssr120 ; PMID: 22259020
- HAM proteins promote organ indeterminacy: but how? DOI: 10.4161/psb.18958 ; PMID: 22353859
- Proper regeneration from in vitro cultured Arabidopsis thaliana requires the microRNA-directed action of an auxin response factor. DOI: 10.1111/j.1365-313X.2012.04944.x ; PMID: 22335436
- Synergistic interaction of CLAVATA1, CLAVATA2, and RECEPTOR-LIKE PROTEIN KINASE 2 in cyst nematode parasitism of Arabidopsis. DOI: 10.1094/MPMI-05-12-0118-FI ; PMID: 22835273
- The shoot apical meristem regulatory peptide CLV3 does not activate innate immunity. DOI: 10.1105/tpc.111.091264 ; PMID: 22923673
- ERECTA-family receptor kinases regulate stem cell homeostasis via buffering its cytokinin responsiveness in the shoot apical meristem. DOI: 10.1093/pcp/pcs109 ; PMID: 22885615
- CCS52A2/FZR1, a cell cycle regulator, is an essential factor for shoot apical meristem maintenance in Arabidopsis thaliana. DOI: 10.1186/1471-2229-12-135 ; PMID: 22873486
- CLE signaling systems during plant development and nematode infection. DOI: 10.1093/pcp/pcs136 ; PMID: 23045524
- Chemical synthesis of Arabidopsis CLV3 glycopeptide reveals the impact of hydroxyproline arabinosylation on peptide conformation and activity. DOI: 10.1093/pcp/pcs174 ; PMID: 23256149
- A set of Arabidopsis thaliana miRNAs involve shoot regeneration in vitro. DOI: 10.4161/psb.23479 ; PMID: 23333958
- Antagonistic peptide technology for functional dissection of CLV3/ESR genes in Arabidopsis. DOI: 10.1104/pp.112.211029 ; PMID: 23321419
- WUSCHEL protein movement and stem cell homeostasis. DOI: 10.4161/psb.19793 ; PMID: 22516820
- GUS activity for miR165a/166b, REV, and WUS/CLV3 in in vitro direct Arabidopsis thaliana shoot regeneration. DOI: 10.1007/s00709-013-0503-1 ; PMID: 23645346
- Individual amino acid residues in CLV3 peptide contribute to its stability in vitro. DOI: 10.4161/psb.25344 ; PMID: 23803748
- CLAVATA3-like genes are differentially expressed in grape vine (Vitis vinifera) tissues. DOI: 10.1016/j.jplph.2013.04.013 ; PMID: 23726469
- Phosphatidylserine synthase 1 is required for inflorescence meristem and organ development in Arabidopsis. DOI: 10.1111/jipb.12045 ; PMID: 23931744
- Incipient stem cell niche conversion in tissue culture: using a systems approach to probe early events in WUSCHEL-dependent conversion of lateral root primordia into shoot meristems. DOI: 10.1111/tpj.12085 ; PMID: 23181633
- A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice. DOI: 10.1093/jxb/ert301 ; PMID: 24043854
- Evolutionarily conserved CLE peptide signaling in plant development, symbiosis, and parasitism. DOI: 10.1016/j.pbi.2013.08.008 ; PMID: 24035739
- The maize Gα gene COMPACT PLANT2 functions in CLAVATA signalling to control shoot meristem size. DOI: 10.1038/nature12583 ; PMID: 24025774
- Spatial expression of CLAVATA3 in the shoot apical meristem suggests it is not a stem cell marker in soybean. DOI: 10.1093/jxb/ert341 ; PMID: 24179098
- The sequence flanking the N-terminus of the CLV3 peptide is critical for its cleavage and activity in stem cell regulation in Arabidopsis. DOI: 10.1186/1471-2229-13-225 ; PMID: 24369789
- Histone H4R3 methylation catalyzed by SKB1/PRMT5 is required for maintaining shoot apical meristem. DOI: 10.1371/journal.pone.0083258 ; PMID: 24349476
- Stereoselective synthesis of Arabidopsis CLAVATA3 (CLV3) glycopeptide, unique protein post-translational modifications of secreted peptide hormone in plant. DOI: 10.1039/c3ob41212a ; PMID: 23912193
- Translational control of Arabidopsis meristem stability and organogenesis by the eukaryotic translation factor eIF3h. DOI: 10.1371/journal.pone.0095396 ; PMID: 24736281
- A regulatory framework for shoot stem cell control integrating metabolic, transcriptional, and phytohormone signals. DOI: 10.1016/j.devcel.2014.01.013 ; PMID: 24576426
- The conflict between cell proliferation and expansion primarily affects stem organogenesis in Arabidopsis. DOI: 10.1093/pcp/pcu131 ; PMID: 25246492
- Tetralocular ovary and high silique width in yellow sarson lines of Brassica rapa (subspecies trilocularis) are due to a mutation in Bra034340 gene, a homologue of CLAVATA3 in Arabidopsis. DOI: 10.1007/s00122-014-2382-z ; PMID: 25205130
- Control of plant stem cell function by conserved interacting transcriptional regulators. DOI: 10.1038/nature13853 ; PMID: 25363783
- A plant U-box protein, PUB4, regulates asymmetric cell division and cell proliferation in the root meristem. DOI: 10.1242/dev.113167 ; PMID: 25605779
- Enhanced resistance to soybean cyst nematode Heterodera glycines in transgenic soybean by silencing putative CLE receptors. DOI: 10.1111/pbi.12313 ; PMID: 25581705
- Germline-transmitted genome editing in Arabidopsis thaliana Using TAL-effector-nucleases. DOI: 10.1371/journal.pone.0121056 ; PMID: 25822541
- Primary root protophloem differentiation requires balanced phosphatidylinositol-4,5-biphosphate levels and systemically affects root branching. DOI: 10.1242/dev.118364 ; PMID: 25813544
- Plant stem cell maintenance by transcriptional cross-regulation of related receptor kinases. DOI: 10.1242/dev.119677 ; PMID: 25758219
- Reevaluation of the CLV3-receptor interaction in the shoot apical meristem: dissection of the CLV3 signaling pathway from a direct ligand-binding point of view. DOI: 10.1111/tpj.12817 ; PMID: 25754504
- Mystery in genetics: PUB4 gives a clue to the complex mechanism of CLV signaling pathway in the shoot apical meristem. DOI: 10.1080/15592324.2015.1028707 ; PMID: 25898239
- Balanced cell proliferation and expansion is essential for flowering stem growth control. DOI: 10.4161/15592324.2014.992755 ; PMID: 25831425
- and CLE40-mediated columella stem cell homeostasis in Arabidopsis. DOI: 10.1093/jxb/erv257 ; PMID: 26019259
- An auxin responsive CLE gene regulates shoot apical meristem development in Arabidopsis. DOI: 10.3389/fpls.2015.00295 ; PMID: 25983737
- BAM 1 and RECEPTOR-LIKE PROTEIN KINASE 2 constitute a signaling pathway and modulate CLE peptide-triggered growth inhibition in Arabidopsis root. DOI: 10.1111/nph.13520 ; PMID: 26083273
- SQUINT promotes stem cell homeostasis and floral meristem termination in Arabidopsis through APETALA2 and CLAVATA signalling. DOI: 10.1093/jxb/erv394 ; PMID: 26269626
- Synergistic action of histone acetyltransferase GCN5 and receptor CLAVATA1 negatively affects ethylene responses in Arabidopsis thaliana. DOI: 10.1093/jxb/erv503 ; PMID: 26596766
- The CLAVATA signaling pathway mediating stem cell fate in shoot meristems requires Ca(2+) as a secondary cytosolic messenger. DOI: 10.1111/tpj.13123 ; PMID: 26756833
- Arabidopsis thaliana gonidialess A/Zuotin related factors (GlsA/ZRF) are essential for maintenance of meristem integrity. DOI: 10.1007/s11103-016-0439-x ; PMID: 26826012
- OBE3 and WUS Interaction in Shoot Meristem Stem Cell Regulation. DOI: 10.1371/journal.pone.0155657 ; PMID: 27196372
- Differential regulation of meristem size, morphology and organization by the ERECTA, CLAVATA and class III HD-ZIP pathways. DOI: 10.1242/dev.129973 ; PMID: 26989178
- FAR-RED ELONGATED HYPOCOTYL3 activates SEPALLATA2 but inhibits CLAVATA3 to regulate meristem determinacy and maintenance in Arabidopsis. DOI: 10.1073/pnas.1602960113 ; PMID: 27469166
- Threshold-dependent transcriptional discrimination underlies stem cell homeostasis. DOI: 10.1073/pnas.1607669113 ; PMID: 27671653
- Matching Patterns of Gene Expression to Mechanical Stiffness at Cell Resolution through Quantitative Tandem Epifluorescence and Nanoindentation. DOI: 10.1104/pp.114.237115 ; PMID: 24924426
- The ERECTA, CLAVATA and class III HD-ZIP Pathways Display Synergistic Interactions in Regulating Floral Meristem Activities. DOI: 10.1371/journal.pone.0125408 ; PMID: 25946150
- Beyond the meristems: similarities in the CLAVATA3 and INFLORESCENCE DEFICIENT IN ABSCISSION peptide mediated signalling pathways. DOI: 10.1093/jxb/erv310 ; PMID: 26105996
- A Molecular Framework for the Embryonic Initiation of Shoot Meristem Stem Cells. DOI: 10.1016/j.devcel.2017.01.002 ; PMID: 28171749
- Sirtinol, a Sir2 protein inhibitor, affects stem cell maintenance and root development in Arabidopsis thaliana by modulating auxin-cytokinin signaling components. DOI: 10.1038/srep42450 ; PMID: 28195159
- CLAVATA1 controls distinct signaling outputs that buffer shoot stem cell proliferation through a two-step transcriptional compensation loop. DOI: 10.1371/journal.pgen.1006681 ; PMID: 28355208
- Dynamic expression reveals a two-step patterning of WUS and CLV3 during axillary shoot meristem formation in Arabidopsis. DOI: 10.1016/j.jplph.2017.03.017 ; PMID: 28399422
- ARR12 promotes de novo shoot regeneration in Arabidopsis thaliana via activation of WUSCHEL expression. DOI: 10.1111/jipb.12567 ; PMID: 28681564
- ARGONAUTE10 Inhibits In Vitro Shoot Regeneration Via Repression of miR165/166 in Arabidopsis thaliana. DOI: 10.1093/pcp/pcx117 ; PMID: 29016889
- A Collection of Mutants for CLE-Peptide-Encoding Genes in Arabidopsis Generated by CRISPR/Cas9-Mediated Gene Targeting. DOI: 10.1093/pcp/pcx139 ; PMID: 29036337
- Regulation of floral meristem activity through the interaction of AGAMOUS, SUPERMAN, and CLAVATA3 in Arabidopsis. DOI: 10.1007/s00497-017-0315-0 ; PMID: 29218596
- A phosphoinositide map at the shoot apical meristem in Arabidopsis thaliana. DOI: 10.1186/s12915-018-0490-y ; PMID: 29415713
- Impairment of Meristem Proliferation in Plants Lacking the Mitochondrial Protease AtFTSH4. DOI: 10.3390/ijms19030853 ; PMID: 29538317
- Expression of CLAVATA3 fusions indicates rapid intracellular processing and a role of ERAD. DOI: 10.1016/j.plantsci.2018.03.020 ; PMID: 29650159
- Cytokinin stabilizes WUSCHEL by acting on the protein domains required for nuclear enrichment and transcription. DOI: 10.1371/journal.pgen.1007351 ; PMID: 29659567
- A Molecular Framework for Auxin-Controlled Homeostasis of Shoot Stem Cells in Arabidopsis. DOI: 10.1016/j.molp.2018.04.006 ; PMID: 29730265
- SUPERMAN regulates floral whorl boundaries through control of auxin biosynthesis. DOI: 10.15252/embj.201797499 ; PMID: 29764982
- PORCUPINE regulates development in response to temperature through alternative splicing. DOI: 10.1038/s41477-018-0176-z ; PMID: 29988152
- HAIRY MERISTEM with WUSCHEL confines CLAVATA3 expression to the outer apical meristem layers. DOI: 10.1126/science.aar8638 ; PMID: 30072538
- The signaling peptide-encoding genes CLE16, CLE17 and CLE27 are dispensable for Arabidopsis shoot apical meristem activity. DOI: 10.1371/journal.pone.0202595 ; PMID: 30114285
- Dual CLAVATA3 Peptides in Arabidopsis Shoot Stem Cell Signaling. DOI: 10.1007/s12374-017-0083-2 ; PMID: 30310351
- Cargo-dependent and cell wall-associated xylem transport in Arabidopsis. DOI: 10.1111/nph.15540 ; PMID: 30317651
- Screening and identification of a non-peptide antagonist for the peptide hormone receptor in Arabidopsis. DOI: 10.1038/s42003-019-0307-8 ; PMID: 30793040
- Comprehensive Analyses of Nitric Oxide-Induced Plant Stem Cell-Related Genes in Arabidopsis thaliana. DOI: 10.3390/genes10030190 ; PMID: 30813477
- CLE-CLAVATA1 Signaling Pathway Modulates Lateral Root Development under Sulfur Deficiency. DOI: 10.3390/plants8040103 ; PMID: 31003469
- Evolution of buffering in a genetic circuit controlling plant stem cell proliferation. DOI: 10.1038/s41588-019-0389-8 ; PMID: 30988512
- An Aminoacyl tRNA Synthetase, OKI1, Is Required for Proper Shoot Meristem Size in Arabidopsis. DOI: 10.1093/pcp/pcz153 ; PMID: 31393575
- Redox-Mediated Endocytosis of a Receptor-Like Kinase during Distal Stem Cell Differentiation Depends on Its Tumor Necrosis Factor Receptor Domain. DOI: 10.1104/pp.19.00616 ; PMID: 31471454
- Transcriptional circuits in control of shoot stem cell homeostasis. DOI: 10.1016/j.pbi.2019.10.004 ; PMID: 31766002
- POLTERGEIST and POLTERGEIST-LIKE1 are essential for the maintenance of post-embryonic shoot and root apical meristems as revealed by a partial loss-of-function mutant allele of pll1 in Arabidopsis. DOI: 10.1007/s13258-019-00894-8 ; PMID: 31797316
- Local and Systemic Effects of Brassinosteroid Perception in Developing Phloem. DOI: 10.1016/j.cub.2020.02.029 ; PMID: 32220322
- Recent Advances in Arabidopsis CLE Peptide Signaling. DOI: 10.1016/j.tplants.2020.04.014 ; PMID: 32402660
- The Type-B Cytokinin Response Regulator ARR1 Inhibits Shoot Regeneration in an ARR12-Dependent Manner in Arabidopsis. DOI: 10.1105/tpc.19.00022 ; PMID: 32398274
- Integration of pluripotency pathways regulates stem cell maintenance in the Arabidopsis shoot meristem. DOI: 10.1073/pnas.2015248117 ; PMID: 32839309
- The Overlapping and Distinct Roles of HAM Family Genes in Arabidopsis Shoot Meristems. DOI: 10.3389/fpls.2020.541968 ; PMID: 33013964
- Morphological and Physiological Framework Underlying Plant Longevity in Arabidopsis thaliana. DOI: 10.3389/fpls.2020.600726 ; PMID: 33224176
- ERECTA family signaling constrains CLAVATA3 and WUSCHEL to the center of the shoot apical meristem. DOI: 10.1242/dev.189753 ; PMID: 33593817
- Stem integrity in Arabidopsis thaliana requires a load-bearing epidermis. DOI: 10.1242/dev.198028 ; PMID: 33637612
- Conserved and differentiated functions of CIK receptor kinases in modulating stem cell signaling in Arabidopsis. DOI: 10.1016/j.molp.2021.04.001 ; PMID: 33823234
- Receptor-like cytoplasmic kinase MAZZA mediates developmental processes with CLAVATA1 family receptors in Arabidopsis. DOI: 10.1093/jxb/erab183 ; PMID: 33909893
- CLAVATA3, a plant peptide controlling stem cell fate in the meristem. DOI: 10.1016/j.peptides.2021.170579 ; PMID: 34033873
- The Cell Fate Controlling CLE40 Peptide Requires CNGCs to Trigger Highly Localized Ca2+ Transients in Arabidopsis thaliana Root Meristems. DOI: 10.1093/pcp/pcab079 ; PMID: 34059877
- Expression of KNUCKLES in the Stem Cell Domain Is Required for Its Function in the Control of Floral Meristem Activity in Arabidopsis. DOI: 10.3389/fpls.2021.704351 ; PMID: 34367223
- Knox homologs shoot meristemless (STM) and KNAT6 are epistatic to CLAVATA3 (CLV3) during shoot meristem development in Arabidopsis thaliana. DOI: 10.1007/s11033-021-06622-4 ; PMID: 34417947
- Robust control of floral meristem determinacy by position-specific multifunctions of KNUCKLES. DOI: 10.1073/pnas.2102826118 ; PMID: 34462349
- Cadmium affects cell niches maintenance in Arabidopsis thaliana post-embryonic shoot and root apical meristem by altering the expression of WUS/WOX homolog genes and cytokinin accumulation. DOI: 10.1016/j.plaphy.2021.09.014 ; PMID: 34530323
- Control of Arabidopsis shoot stem cell homeostasis by two antagonistic CLE peptide signalling pathways. DOI: 10.7554/eLife.70934 ; PMID: 34643181
- CLAVATA3 mediated simultaneous control of transcriptional and post-translational processes provides robustness to the WUSCHEL gradient. DOI: 10.1038/s41467-021-26586-0 ; PMID: 34737298
- CLE peptides: critical regulators for stem cell maintenance in plants. DOI: 10.1007/s00425-021-03791-1 ; PMID: 34841457
- Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis. DOI: 10.1093/plcell/koab315 ; PMID: 34935965
- Control of Root Stem Cell Differentiation and Lateral Root Emergence by CLE16/17 Peptides in Arabidopsis. DOI: 10.3389/fpls.2022.869888 ; PMID: 35519820
- Evolution of meristem zonation by CLE gene duplication in land plants. DOI: 10.1038/s41477-022-01199-7 ; PMID: 35854003
- De novo stem cell establishment in meristems requires repression of organ boundary cell fate. DOI: 10.1093/plcell/koac269 ; PMID: 36029254
- Interactive CLV3, CLE16 and CLE17 signaling mediates stem cell homeostasis in the Arabidopsis shoot apical meristem. DOI: 10.1242/dev.200787 ; PMID: 36111520
- Genome-wide identification and comparative analysis of CLE family in rapeseed and its diploid progenitors. DOI: 10.3389/fpls.2022.998082 ; PMID: 36340404
- CLE3 and its homologs share overlapping functions in the modulation of lateral root formation through CLV1 and BAM1 in Arabidopsis thaliana. DOI: 10.1111/tpj.16103 ; PMID: 36628476
- A phosphoinositide hub connects CLE peptide signaling and polar auxin efflux regulation. DOI: 10.1038/s41467-023-36200-0 ; PMID: 36702874
- pH-dependent CLE peptide perception permits phloem differentiation in Arabidopsis roots. DOI: 10.1016/j.cub.2022.12.056 ; PMID: 36693368
- The AtERF19 gene regulates meristem activity and flower organ size in plants. DOI: 10.1111/tpj.16196 ; PMID: 36932949
- How flower development genes were identified using forward genetic screens in Arabidopsis thaliana. DOI: 10.1093/genetics/iyad102 ; PMID: 37294732
- Dependence of stem cell fate in Arabidopsis on a feedback loop regulated by CLV3 activity. DOI: 10.1126/science.289.5479.617 ; PMID: 10915624
Sequence:
cDNA Sequence
- >AT2G27250.3 AGTTTCTATATTTCTCTCTTTATCTCTCTCACTCAGTCACTTTCTCTCTAAAAATGGATTCGAAGAGTTTTCTGCTACTACTACTACTCTTCTGCTTCTTGTTCCTTCATGATGCTTCTGATCTCACTCAAGCTCATGCTCACGTTCAAGGACTTTCCAACCGCAAGATGATGATGATGAAAATGGAAAGTGAATGGGTTGGAGCAAATGGAGAAGCAGAGAAGGCAAAGACGAAGGGTTTAGGACTACATGAAGAGTTAAGGACTGTTCCTTCGGGACCTGACCCGTTGCACCATCATGTGAACCCACCAAGACAGCCAAGAAACAACTTTCAGCTCCCTTGACCTAATCTCTTGTTGCTTTAAATTATTTCATATTGTAAATTACTTTCTGCTTTATCGGTTTTACCATTTCGGGAGTCTTTTTTGTGTGCAATCTGTTTCGTTTGGTAAGCTTGTAGTTTCATGAAAGTGAATGTAAGATATGCATTACGTTTGTTGCTGAAGTGAATGTAAGATACGCACTATTATATCTCATGATTTTCTAAGAAAA
- >AT2G27250.1 AGTTTCTATATTTCTCTCTTTATCTCTCTCACTCAGTCACTTTCTCTCTAAAAATGGATTCGAAGAGTTTTCTGCTACTACTACTACTCTTCTGCTTCTTGTTCCTTCATGATGCTTCTGATCTCACTCAAGCTCATGCTCACGTTCAAGGACTTTCCAACCGCAAGATGATGATGATGAAAATGGAAAGTGAATGGGTTGGAGCAAATGGAGAAGCAGAGAAGGCAAAGACGAAGGGTTTAGGACTACATGAAGAGTTAAGGACTGTTCCTTCGGGACCTGACCCGTTGCACCATCATGTGAACCCACCAAGACAGCCAAGAAACAACTTTCAGCTCCCTTGACCTAATCTCTTGTTGCTTTAAATTATTTCATATTGTAAATTACTTTCTGCTTTATCGGTTTTACCATTTCGGGAGTCTTTTTTGTGTGCAATCTGTTTCGTTTGGTAAGCTTGTAGTTTCATGAAAGTGAATGTAAGATATGCATTACGTTTGTTGCTGAAGTGAATGTAAGATACGCACTATTATATCTCATGATTTTCTAAGAAAA
- >AT2G27250.2 AGTTTCTATATTTCTCTCTTTATCTCTCTCACTCAGTCACTTTCTCTCTAAAAATGGATTCGAAGAGTTTTCTGCTACTACTACTACTCTTCTGCTTCTTGTTCCTTCATGATGCTTCTGATCTCACTCAAGCTCATGCTCACGTTCAAGGACTTTCCAACCGCAAGATGATGATGATGAAAATGGAAAGTGAATGGGTTGGAGCAAATGGAGAAGCAGAGAAGGCAAAGACGAAGGGTTTAGGACTACATGAAGAGTTAAGGACTGTTCCTTCGGGACCTGACCCGTTGCACCATCATGTGAACCCACCAAGACAGCCAAGAAACAACTTTCAGCTCCCTTGACCTAATCTCTTGTTGCTTTAAATTATTTCATATTGTAAATTACTTTCTGCTTTATCGGTTTTACCATTTCGGGAGTCTTTTTTGTGTGCAATCTGTTTCGTTTGGTAAGCTTGTAGTTTCATGAAAGTGAATGTAAGATATGCATTACGTTTGTTGCTGAAGTGAATGTAAGATACGCACTATTATATCTCATGATTTTCTAAGAAAA
CDS Sequence
- >AT2G27250.3 ATGGATTCGAAGAGTTTTCTGCTACTACTACTACTCTTCTGCTTCTTGTTCCTTCATGATGCTTCTGATCTCACTCAAGCTCATGCTCACGTTCAAGGACTTTCCAACCGCAAGATGATGATGATGAAAATGGAAAGTGAATGGGTTGGAGCAAATGGAGAAGCAGAGAAGGCAAAGACGAAGGGTTTAGGACTACATGAAGAGTTAAGGACTGTTCCTTCGGGACCTGACCCGTTGCACCATCATGTGAACCCACCAAGACAGCCAAGAAACAACTTTCAGCTCCCTTGA
- >AT2G27250.1 ATGGATTCGAAGAGTTTTCTGCTACTACTACTACTCTTCTGCTTCTTGTTCCTTCATGATGCTTCTGATCTCACTCAAGCTCATGCTCACGTTCAAGGACTTTCCAACCGCAAGATGATGATGATGAAAATGGAAAGTGAATGGGTTGGAGCAAATGGAGAAGCAGAGAAGGCAAAGACGAAGGGTTTAGGACTACATGAAGAGTTAAGGACTGTTCCTTCGGGACCTGACCCGTTGCACCATCATGTGAACCCACCAAGACAGCCAAGAAACAACTTTCAGCTCCCTTGA
- >AT2G27250.2 ATGGATTCGAAGAGTTTTCTGCTACTACTACTACTCTTCTGCTTCTTGTTCCTTCATGATGCTTCTGATCTCACTCAAGCTCATGCTCACGTTCAAGGACTTTCCAACCGCAAGATGATGATGATGAAAATGGAAAGTGAATGGGTTGGAGCAAATGGAGAAGCAGAGAAGGCAAAGACGAAGGGTTTAGGACTACATGAAGAGTTAAGGACTGTTCCTTCGGGACCTGACCCGTTGCACCATCATGTGAACCCACCAAGACAGCCAAGAAACAACTTTCAGCTCCCTTGA
Protein Sequence
- >AT2G27250.3 MDSKSFLLLLLLFCFLFLHDASDLTQAHAHVQGLSNRKMMMMKMESEWVGANGEAEKAKTKGLGLHEELRTVPSGPDPLHHHVNPPRQPRNNFQLP
- >AT2G27250.1 MDSKSFLLLLLLFCFLFLHDASDLTQAHAHVQGLSNRKMMMMKMESEWVGANGEAEKAKTKGLGLHEELRTVPSGPDPLHHHVNPPRQPRNNFQLP
- >AT2G27250.2 MDSKSFLLLLLLFCFLFLHDASDLTQAHAHVQGLSNRKMMMMKMESEWVGANGEAEKAKTKGLGLHEELRTVPSGPDPLHHHVNPPRQPRNNFQLP