Gene Details:
- Gene ID: AT2G29980
- Gene Symbol: AtFAD3, FAD3
- Gene Name: fatty acid desaturase 3
- Description: fatty acid desaturase 3;(source:Araport11)
- TAIR Accession: locus:2005508
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0000037 — shoot axis apex — ápice del epiblasto (epiblastema) (Spanish, exact), シュート頂、茎頂 (Japanese, exact)
- PO:0008019 — leaf lamina base — base de la lámina de la hoja (Spanish, exact), 葉身基部 (Japanese, exact)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009006 — shoot system — sistema de epiblasto (epiblastema) (Spanish, exact), シュート系、苗条系 (Japanese, exact), Poaceae crown (related), shoot (related), thalli (related), thallus (related), tree crown (narrow)
- PO:0009009 — plant embryo — embrión (Spanish, exact), 植物胚 (Japanese, exact), germ (related), embryo (broad)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009029 — stamen — estambre (Spanish, exact), 雄蕊 (Japanese, exact), Poaceae stamen (narrow), Zea stamen (narrow)
- PO:0009031 — sepal — sépalo (Spanish, exact), がく片 (Japanese, exact)
- PO:0009046 — flower — flor (Spanish, exact), 花 (Japanese, exact), floret (related), Asteraceae floret (narrow), basal flower (narrow), double flower (narrow), hermaphrodite flower (narrow), monoclinous flower (narrow), perfect flower (narrow)
- PO:0009052 — inflorescence flower pedicel — 小花柄 (Japanese, related), pedicelo (Spanish, broad)
- PO:0020030 — cotyledon — cotiledón (Spanish, exact), seed leaf (exact), 子葉 (Japanese, exact)
- PO:0020038 — petiole — pecíolo (Spanish, exact), 葉柄 (Japanese, exact)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
- PO:0020137 — leaf apex — ápice de la hoja (Spanish, exact), 葉先 (Japanese, exact), leaf lamina apex (narrow), phyllid apex (narrow)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0000084 — plant sperm cell — célula espermática o esperma (Spanish, exact), male gamete (exact), microgamete (exact), 植物精子細胞 (Japanese, exact), sperm nucleus (related), sperm cell (broad)
- PO:0025195 — pollen tube cell — célula del tubo polínico (Spanish, exact), 花粉管細胞 (Japanese, exact)
Gene Ontology:
- GO:0042389 — enables — omega-3 fatty acid desaturase activity
- GO:0009507 — located in — chloroplast
- GO:0102859 — enables — 1-18:1-2-18:2-phosphatidylcholine desaturase activity (SN2-18:3 forming)
- GO:0006636 — involved in — unsaturated fatty acid biosynthetic process
- GO:0102862 — enables — 1-18:2-2-18:2-sn-glycerol-3-phosphocholine desaturase activity (SN2-18:3 forming)
- GO:0005783 — located in — endoplasmic reticulum
- GO:0006636 — acts upstream of or within — unsaturated fatty acid biosynthetic process
- GO:0102856 — enables — 1-18:2-2-18:2-sn-glycerol-3-phosphocholine desaturase activity
- GO:0102872 — enables — 1-16:0-2-18:2-phosphatidylcholine desaturase activity
- GO:0016717 — enables — oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
Germplasm Phenotype:
- CS8034 — reduction in desaturation of storage and membrane lipids; deficient in lineolate desaturase, 18:2; deficient in endoplasmic reticulum lipids; no visible phenotypic effects.
Function-related keywords:
- shoot axis apex , leaf lamina base , root , shoot system , plant embryo , vascular leaf , stamen , sepal , flower , inflorescence flower pedicel , cotyledon , petiole , hypocotyl , leaf apex , collective leaf structure , pollen , plant sperm cell , pollen tube cell , pollen
Literature:
- DGD1-independent biosynthesis of extraplastidic galactolipids after phosphate deprivation in Arabidopsis. DOI: 10.1073/pnas.180320497 ; PMID: 10973486
- Wounding and chemicals induce expression of the Arabidopsis thaliana gene Thi2.1, encoding a fungal defense thionin, via the octadecanoid pathway. DOI: 10.1016/s0014-5793(98)01251-4 ; PMID: 9824308
- A role for jasmonate in pathogen defense of Arabidopsis. DOI: 10.1073/pnas.95.12.7209 ; PMID: 9618564
- Overexpression of the FAD3 desaturase gene in a mutant of Arabidopsis. DOI: 10.1104/pp.114.4.1533 ; PMID: 9276960
- Identification of an animal omega-3 fatty acid desaturase by heterologous expression in Arabidopsis. DOI: 10.1073/pnas.94.4.1142 ; PMID: 9037020
- The impact of alteration of polyunsaturated fatty acid levels on C6-aldehyde formation of Arabidopsis thaliana leaves. DOI: 10.1104/pp.111.3.805 ; PMID: 8754681
- Cloning of a temperature-regulated gene encoding a chloroplast omega-3 desaturase from Arabidopsis thaliana. DOI: 10.1104/pp.106.4.1615 ; PMID: 7846164
- A gene encoding a chloroplast omega-3 fatty acid desaturase complements alterations in fatty acid desaturation and chloroplast copy number of the fad7 mutant of Arabidopsis thaliana. DOI: S0021-9258(20)80498-0 ; PMID: 8226956
- Cloning of higher plant omega-3 fatty acid desaturases. DOI: 10.1104/pp.103.2.467 ; PMID: 8029334
- Mutants of Arabidopsis deficient in the synthesis of alpha-linolenate. Biochemical and genetic characterization of the endoplasmic reticulum linoleoyl desaturase. DOI: S0021-9258(19)85427-3 ; PMID: 8102138
- Plant defense in the absence of jasmonic acid: the role of cyclopentenones. DOI: 10.1073/pnas.211311098 ; PMID: 11592974
- Digalactosyldiacylglycerol synthesis in chloroplasts of the Arabidopsis dgd1 mutant. DOI: 10.1104/pp.010780 ; PMID: 11891245
- Jasmonate is essential for insect defense in Arabidopsis. DOI: 10.1073/pnas.94.10.5473 ; PMID: 11038546
- Photoinhibition in mutants of Arabidopsis deficient in thylakoid unsaturation. DOI: 10.1104/pp.004341 ; PMID: 12068126
- and jasmonate-mediated pathways in the Wassilewskija ecotype of Arabidopsis thaliana. DOI: 10.1046/j.1365-294x.2003.01815.x ; PMID: 12694277
- Hormonal regulation of tissue-specific ectopic expression of an Arabidopsis endoplasmic reticulum-type omega-3 fatty acid desaturase (FAD3) gene. DOI: 10.1007/s004250100575 ; PMID: 11722119
- Jasmonic acid signaling modulates ozone-induced hypersensitive cell death. DOI: 10.1105/tpc.12.9.1633 ; PMID: 11006337
- Natural variation for seed oil composition in Arabidopsis thaliana. DOI: 10.1016/s0031-9422(03)00351-0 ; PMID: 14568074
- Heterologous expression of a fatty acid hydroxylase gene in developing seeds of Arabidopsis thaliana. DOI: 10.1007/s00425-003-1015-6 ; PMID: 14520576
- Membrane-bound fatty acid desaturases are inserted co-translationally into the ER and contain different ER retrieval motifs at their carboxy termini. DOI: 10.1111/j.1365-313x.2004.01949.x ; PMID: 14690501
- Level of accumulation of epoxy fatty acid in Arabidopsis thaliana expressing a linoleic acid delta12-epoxygenase is influenced by the availability of the substrate linoleic acid. DOI: 10.1007/s00122-004-1721-x ; PMID: 15221145
- Plant growth-promoting rhizobacteria systemically protect Arabidopsis thaliana against Cucumber mosaic virus by a salicylic acid and NPR1-independent and jasmonic acid-dependent signaling pathway. DOI: 10.1111/j.1365-313X.2004.02142.x ; PMID: 15255867
- Role of salicylic acid and fatty acid desaturation pathways in ssi2-mediated signaling. DOI: 10.1104/pp.105.071662 ; PMID: 16306139
- Conjugated fatty acids accumulate to high levels in phospholipids of metabolically engineered soybean and Arabidopsis seeds. DOI: 10.1016/j.phytochem.2006.04.013 ; PMID: 16762380
- Altered rates of protein transport in Arabidopsis mutants deficient in chloroplast membrane unsaturation. DOI: 10.1016/j.phytochem.2006.04.008 ; PMID: 16759675
- Insights into the role of specific lipids in the formation and delivery of lipid microdomains to the plasma membrane of plant cells. DOI: 10.1104/pp.106.091496 ; PMID: 17114270
- Silverleaf whitefly induces salicylic acid defenses and suppresses effectual jasmonic acid defenses. DOI: 10.1104/pp.106.090035 ; PMID: 17189328
- The role of pectate lyase and the jasmonic acid defense response in Pseudomonas viridiflava virulence. DOI: 10.1094/MPMI-20-2-0146 ; PMID: 17313166
- Alternative oxidase involvement in cold stress response of Arabidopsis thaliana fad2 and FAD3+ cell suspensions altered in membrane lipid composition. DOI: 10.1093/pcp/pcm061 ; PMID: 17507388
- Genetic removal of tri-unsaturated fatty acids suppresses developmental and molecular phenotypes of an Arabidopsis tocopherol-deficient mutant. Whole-body mapping of malondialdehyde pools in a complex eukaryote. DOI: 10.1074/jbc.M706838200 ; PMID: 17928299
- Tocopherols modulate extraplastidic polyunsaturated fatty acid metabolism in Arabidopsis at low temperature. DOI: 10.1105/tpc.107.054718 ; PMID: 18314499
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. DOI: 10.1104/pp.108.126375 ; PMID: 18775970
- Nonenzymatic oxidation of trienoic fatty acids contributes to reactive oxygen species management in Arabidopsis. DOI: 10.1074/jbc.M807114200 ; PMID: 18996838
- Overexpression of a FAD3 desaturase increases synthesis of a polymethylene-interrupted dienoic fatty acid in seeds of Arabidopsis thaliana L. DOI: 10.1007/s11745-009-3315-5 ; PMID: 19548018
- The power of mutants for investigating jasmonate biosynthesis and signaling. DOI: 10.1016/j.phytochem.2009.08.004 ; PMID: 19740496
- Genetically modified Arabidopsis thaliana cells reveal the involvement of the mitochondrial fatty acid composition in membrane basal and uncoupling protein-mediated proton leaks. DOI: 10.1093/pcp/pcp144 ; PMID: 19875678
- Karrikins enhance light responses during germination and seedling development in Arabidopsis thaliana. DOI: 10.1073/pnas.0911635107 ; PMID: 20351290
- The octadecanoid signaling pathway participates in the chilling-induced transcription of ω-3 fatty acid desaturases in Arabidopsis. DOI: 10.1016/j.plaphy.2010.11.013 ; PMID: 21185196
- Towards the genetic architecture of seed lipid biosynthesis and accumulation in Arabidopsis thaliana. DOI: 10.1038/hdy.2011.54 ; PMID: 21731053
- Two high linolenic mutants of Arabidopsis thaliana contain megabase-scale genome duplications encompassing the FAD3 locus. DOI: 10.1111/j.1365-313X.2011.04742.x ; PMID: 21848868
- Microarray analysis of differentially expressed genes between Brassica napus and low-oleic acid contents. DOI: 10.1007/s00299-011-1213-9 ; PMID: 22203212
- and long-term thermotolerance have different requirements for trienoic fatty acids. DOI: 10.1093/jxb/err381 ; PMID: 22140238
- Triacylglycerol synthesis by PDAT1 in the absence of DGAT1 activity is dependent on re-acylation of LPC by LPCAT2. DOI: 10.1186/1471-2229-12-4 ; PMID: 22233193
- In silico identification and comparative genomics of candidate genes involved in biosynthesis and accumulation of seed oil in plants. DOI: 10.1155/2012/914843 ; PMID: 22312320
- Higher plant cytochrome b5 polypeptides modulate fatty acid desaturation. DOI: 10.1371/journal.pone.0031370 ; PMID: 22384013
- Acyl-lipid metabolism. DOI: 10.1199/tab.0161 ; PMID: 23505340
- bZIP67 regulates the omega-3 fatty acid content of Arabidopsis seed oil by activating fatty acid desaturase3. DOI: 10.1105/tpc.113.116343 ; PMID: 23995083
- Specific molecular marker of the genes controlling linolenic acid content in rapeseed. DOI: 10.1007/BF00417942 ; PMID: 24162342
- Mutants of Arabidopsis with alterations in seed lipid fatty acid composition. DOI: 10.1007/BF00224392 ; PMID: 24220901
- TRANSPARENT TESTA2 regulates embryonic fatty acid biosynthesis by targeting FUSCA3 during the early developmental stage of Arabidopsis seeds. DOI: 10.1111/tpj.12426 ; PMID: 24397827
- Two fatty acid desaturases, STEAROYL-ACYL CARRIER PROTEIN Δ9-DESATURASE6 and FATTY ACID DESATURASE3, are involved in drought and hypoxia stress signaling in Arabidopsis crown galls. DOI: 10.1104/pp.113.230326 ; PMID: 24368335
- FAD2 and FAD3 desaturases form heterodimers that facilitate metabolic channeling in vivo. DOI: 10.1074/jbc.M114.572883 ; PMID: 24811169
- Combined transgenic expression of Punica granatum conjugase (FADX) and FAD2 desaturase in high linoleic acid Arabidopsis thaliana mutant leads to increased accumulation of punicic acid. DOI: 10.1007/s00425-014-2109-z ; PMID: 25000918
- The toc132toc120 heterozygote mutant of Arabidopsis thaliana accumulates reduced levels of hexadecatrienoic acid. DOI: 10.1016/j.plaphy.2015.09.006 ; PMID: 26381195
- Levels of polyunsaturated fatty acids correlate with growth rate in plant cell cultures. DOI: 10.1038/srep15207 ; PMID: 26469123
- ALA10, a Phospholipid Flippase, Controls FAD2/FAD3 Desaturation of Phosphatidylcholine in the ER and Affects Chloroplast Lipid Composition in Arabidopsis thaliana. DOI: 10.1104/pp.15.01557 ; PMID: 26620528
- Cytochrome b5 Reductase 1 Triggers Serial Reactions that Lead to Iron Uptake in Plants. DOI: 10.1016/j.molp.2015.12.010 ; PMID: 26712506
- Membranes as Structural Antioxidants: RECYCLING OF MALONDIALDEHYDE TO ITS SOURCE IN OXIDATION-SENSITIVE CHLOROPLAST FATTY ACIDS. DOI: 10.1074/jbc.M116.729921 ; PMID: 27143359
- Histone acetyltransferase general control non-repressed protein 5 (GCN5) affects the fatty acid composition of Arabidopsis thaliana seeds by acetylating fatty acid desaturase3 (FAD3). DOI: 10.1111/tpj.13300 ; PMID: 27500884
- Genome Wide Analysis of Fatty Acid Desaturation and Its Response to Temperature. DOI: 10.1104/pp.16.01907 ; PMID: 28108698
- Effects of eIFiso4G1 mutation on seed oil biosynthesis. DOI: 10.1111/tpj.13522 ; PMID: 28244172
- A Plastid Phosphatidylglycerol Lipase Contributes to the Export of Acyl Groups from Plastids for Seed Oil Biosynthesis. DOI: 10.1105/tpc.17.00397 ; PMID: 28687655
- A Role for Tocopherol Biosynthesis in Arabidopsis Basal Immunity to Bacterial Infection. DOI: 10.1104/pp.19.00618 ; PMID: 31515446
- Polyunsaturated linolenoyl-CoA modulates ERF-VII-mediated hypoxia signaling in Arabidopsis. DOI: 10.1111/jipb.12875 ; PMID: 31595698
- Plant surface metabolites as potent antifungal agents. DOI: 10.1016/j.plaphy.2020.02.026 ; PMID: 32112998
- Fatty Acid Desaturases in the Chloroplast and Endoplasmic Reticulum Promote Susceptibility to the Green Peach Aphid Myzus persicae in Arabidopsis thaliana. DOI: 10.1094/MPMI-12-20-0345-R ; PMID: 33596108
- The seed-specific transcription factor DPBF2 modulates the fatty acid composition in seeds. DOI: 10.1002/pld3.395 ; PMID: 35388372
- Cloning of higher plant omega-3 fatty acid desaturases. DOI: 10.1104/pp.103.2.467 ; PMID: 8029334
Sequence:
cDNA Sequence
- >AT2G29980.2 CACCACATTATTTTCACTGAGCGCATAACATTTTTGAGACAAGAGACTCTCTCTCTCTCTCTTCTCTCTTTCTCTCCCCCTCTCTCCGGCGATGGTTGTTGCTATGGACCAACGCACCAATGTGAACGGAGATCCCGGCGCCGGAGACCGGAAGAAAGAAGAAAGGTTTGATCCGAGTGCACAACCACCGTTCAAGATCGGAGATATAAGGGCGGCGATTCCTAAGCACTGTTGGGTTAAGAGTCCTTTGAGATCAATGAGTTACGTCGTCAGAGACATTATCGCCGTCGCGGCTTTGGCCATCGCTGCCGTGTATGTTGATAGCTGGTTCCTTTGGCCTCTTTATTGGGCCGCCCAAGGAACACTTTTCTGGGCCATCTTTGTTCTCGGCCACGACTGTGGACATGGGAGTTTCTCAGACATTCCTCTACTGAATAGTGTGGTTGGTCACATTCTTCATTCTTTCATCCTCGTTCCTTACCATGGTTGGAGAATAAGCCACCGGACACACCACCAGAACCATGGCCATGTTGAAAACGACGAGTCATGGGTTCCGTTACCAGAAAGGGTGTACAAGAAATTGCCCCACAGTACTCGGATGCTCAGATACACTGTCCCTCTCCCCATGCTCGCATATCCTCTCTATTTGTGCTACAGAAGTCCTGGAAAAGAAGGATCACATTTTAACCCATACAGTAGTTTATTTGCTCCAAGCGAGAGAAAGCTTATTGCAACTTCAACTACTTGTTGGTCCATAATGTTCGTCAGTCTTATCGCTCTATCTTTCGTCTTCGGTCCACTCGCGGTTCTTAAAGTCTACGGTGTACCGTACATTATCTTTGTGATGTGGTTGGATGCTGTCACGTATTTGCATCATCATGGTCACGATGAGAAGTTGCCTTGGTATAGAGGCAAGGTAAGTAAAATCAAATATATATGTTTTGTAACAGAAAATTAGCGATGTTATGGATTAATGGATTTGTTTGATTAATAGGAATGGAGTTATCTACGTGGAGGATTAACAACAATTGATAGAGATTACGGAATCTTTAACAACATTCATCACGACATTGGAACTCACGTGATCCATCATCTCTTCCCACAAATCCCTCACTATCACTTGGTCGACGCCACGAAAGCAGCTAAACATGTGTTGGGAAGATACTACAGAGAACCAAAGACGTCAGGAGCAATACCGATCCACTTGGTGGAGAGTTTGGTCGCAAGTATTAAGAAAGATCATTACGTCAGCGACACTGGTGATATTGTCTTCTACGAGACAGATCCAGATCTCTACGTTTACGCTTCTGACAAATCTAAAATCAATTAATCTCCATTTGTTTAGCTCTATTAGGAATAAACCAGCCCACTTTTAAAATTTTTATTTCTTGTTGTTTTTAAGTTAAAAGTGTACTCGTGAAACTCTTTTTTTTTTCTTTTTTTTTTATTAATGTATTTACATTACAAGGCGTAAAGTTTTGTTATTTCTCTTTTCTTCTTTTAGTTACCATCAAAAAGATTTCAAT
- >AT2G29980.1 CACCACATTATTTTCACTGAGCGCATAACATTTTTGAGACAAGAGACTCTCTCTCTCTCTCTTCTCTCTTTCTCTCCCCCTCTCTCCGGCGATGGTTGTTGCTATGGACCAACGCACCAATGTGAACGGAGATCCCGGCGCCGGAGACCGGAAGAAAGAAGAAAGGTTTGATCCGAGTGCACAACCACCGTTCAAGATCGGAGATATAAGGGCGGCGATTCCTAAGCACTGTTGGGTTAAGAGTCCTTTGAGATCAATGAGTTACGTCGTCAGAGACATTATCGCCGTCGCGGCTTTGGCCATCGCTGCCGTGTATGTTGATAGCTGGTTCCTTTGGCCTCTTTATTGGGCCGCCCAAGGAACACTTTTCTGGGCCATCTTTGTTCTCGGCCACGACTGTGGACATGGGAGTTTCTCAGACATTCCTCTACTGAATAGTGTGGTTGGTCACATTCTTCATTCTTTCATCCTCGTTCCTTACCATGGTTGGAGAATAAGCCACCGGACACACCACCAGAACCATGGCCATGTTGAAAACGACGAGTCATGGGTTCCGTTACCAGAAAGGGTGTACAAGAAATTGCCCCACAGTACTCGGATGCTCAGATACACTGTCCCTCTCCCCATGCTCGCATATCCTCTCTATTTGTGCTACAGAAGTCCTGGAAAAGAAGGATCACATTTTAACCCATACAGTAGTTTATTTGCTCCAAGCGAGAGAAAGCTTATTGCAACTTCAACTACTTGTTGGTCCATAATGTTCGTCAGTCTTATCGCTCTATCTTTCGTCTTCGGTCCACTCGCGGTTCTTAAAGTCTACGGTGTACCGTACATTATCTTTGTGATGTGGTTGGATGCTGTCACGTATTTGCATCATCATGGTCACGATGAGAAGTTGCCTTGGTATAGAGGCAAGGTAAGTAAAATCAAATATATATGTTTTGTAACAGAAAATTAGCGATGTTATGGATTAATGGATTTGTTTGATTAATAGGAATGGAGTTATCTACGTGGAGGATTAACAACAATTGATAGAGATTACGGAATCTTTAACAACATTCATCACGACATTGGAACTCACGTGATCCATCATCTCTTCCCACAAATCCCTCACTATCACTTGGTCGACGCCACGAAAGCAGCTAAACATGTGTTGGGAAGATACTACAGAGAACCAAAGACGTCAGGAGCAATACCGATCCACTTGGTGGAGAGTTTGGTCGCAAGTATTAAGAAAGATCATTACGTCAGCGACACTGGTGATATTGTCTTCTACGAGACAGATCCAGATCTCTACGTTTACGCTTCTGACAAATCTAAAATCAATTAATCTCCATTTGTTTAGCTCTATTAGGAATAAACCAGCCCACTTTTAAAATTTTTATTTCTTGTTGTTTTTAAGTTAAAAGTGTACTCGTGAAACTCTTTTTTTTTTCTTTTTTTTTTATTAATGTATTTACATTACAAGGCGTAAAGTTTTGTTATTTCTCTTTTCTTCTTTTAGTTACCATCAAAAAGATTTCAAT
CDS Sequence
- >AT2G29980.2 ATGGTTGTTGCTATGGACCAACGCACCAATGTGAACGGAGATCCCGGCGCCGGAGACCGGAAGAAAGAAGAAAGGTTTGATCCGAGTGCACAACCACCGTTCAAGATCGGAGATATAAGGGCGGCGATTCCTAAGCACTGTTGGGTTAAGAGTCCTTTGAGATCAATGAGTTACGTCGTCAGAGACATTATCGCCGTCGCGGCTTTGGCCATCGCTGCCGTGTATGTTGATAGCTGGTTCCTTTGGCCTCTTTATTGGGCCGCCCAAGGAACACTTTTCTGGGCCATCTTTGTTCTCGGCCACGACTGTGGACATGGGAGTTTCTCAGACATTCCTCTACTGAATAGTGTGGTTGGTCACATTCTTCATTCTTTCATCCTCGTTCCTTACCATGGTTGGAGAATAAGCCACCGGACACACCACCAGAACCATGGCCATGTTGAAAACGACGAGTCATGGGTTCCGTTACCAGAAAGGGTGTACAAGAAATTGCCCCACAGTACTCGGATGCTCAGATACACTGTCCCTCTCCCCATGCTCGCATATCCTCTCTATTTGTGCTACAGAAGTCCTGGAAAAGAAGGATCACATTTTAACCCATACAGTAGTTTATTTGCTCCAAGCGAGAGAAAGCTTATTGCAACTTCAACTACTTGTTGGTCCATAATGTTCGTCAGTCTTATCGCTCTATCTTTCGTCTTCGGTCCACTCGCGGTTCTTAAAGTCTACGGTGTACCGTACATTATCTTTGTGATGTGGTTGGATGCTGTCACGTATTTGCATCATCATGGTCACGATGAGAAGTTGCCTTGGTATAGAGGCAAGGTAAGTAAAATCAAATATATATGTTTTGTAACAGAAAATTAG
- >AT2G29980.1 ATGGTTGTTGCTATGGACCAACGCACCAATGTGAACGGAGATCCCGGCGCCGGAGACCGGAAGAAAGAAGAAAGGTTTGATCCGAGTGCACAACCACCGTTCAAGATCGGAGATATAAGGGCGGCGATTCCTAAGCACTGTTGGGTTAAGAGTCCTTTGAGATCAATGAGTTACGTCGTCAGAGACATTATCGCCGTCGCGGCTTTGGCCATCGCTGCCGTGTATGTTGATAGCTGGTTCCTTTGGCCTCTTTATTGGGCCGCCCAAGGAACACTTTTCTGGGCCATCTTTGTTCTCGGCCACGACTGTGGACATGGGAGTTTCTCAGACATTCCTCTACTGAATAGTGTGGTTGGTCACATTCTTCATTCTTTCATCCTCGTTCCTTACCATGGTTGGAGAATAAGCCACCGGACACACCACCAGAACCATGGCCATGTTGAAAACGACGAGTCATGGGTTCCGTTACCAGAAAGGGTGTACAAGAAATTGCCCCACAGTACTCGGATGCTCAGATACACTGTCCCTCTCCCCATGCTCGCATATCCTCTCTATTTGTGCTACAGAAGTCCTGGAAAAGAAGGATCACATTTTAACCCATACAGTAGTTTATTTGCTCCAAGCGAGAGAAAGCTTATTGCAACTTCAACTACTTGTTGGTCCATAATGTTCGTCAGTCTTATCGCTCTATCTTTCGTCTTCGGTCCACTCGCGGTTCTTAAAGTCTACGGTGTACCGTACATTATCTTTGTGATGTGGTTGGATGCTGTCACGTATTTGCATCATCATGGTCACGATGAGAAGTTGCCTTGGTATAGAGGCAAGGTAAGTAAAATCAAATATATATGTTTTGTAACAGAAAATTAG
Protein Sequence
- >AT2G29980.2 MVVAMDQRTNVNGDPGAGDRKKEERFDPSAQPPFKIGDIRAAIPKHCWVKSPLRSMSYVVRDIIAVAALAIAAVYVDSWFLWPLYWAAQGTLFWAIFVLGHDCGHGSFSDIPLLNSVVGHILHSFILVPYHGWRISHRTHHQNHGHVENDESWVPLPERVYKKLPHSTRMLRYTVPLPMLAYPLYLCYRSPGKEGSHFNPYSSLFAPSERKLIATSTTCWSIMFVSLIALSFVFGPLAVLKVYGVPYIIFVMWLDAVTYLHHHGHDEKLPWYRGKVSKIKYICFVTEN
- >AT2G29980.1 MVVAMDQRTNVNGDPGAGDRKKEERFDPSAQPPFKIGDIRAAIPKHCWVKSPLRSMSYVVRDIIAVAALAIAAVYVDSWFLWPLYWAAQGTLFWAIFVLGHDCGHGSFSDIPLLNSVVGHILHSFILVPYHGWRISHRTHHQNHGHVENDESWVPLPERVYKKLPHSTRMLRYTVPLPMLAYPLYLCYRSPGKEGSHFNPYSSLFAPSERKLIATSTTCWSIMFVSLIALSFVFGPLAVLKVYGVPYIIFVMWLDAVTYLHHHGHDEKLPWYRGKVSKIKYICFVTEN