Gene Details:
- Gene ID: AT2G38810
- Gene Symbol: H2A.Z, HTA8
- Gene Name: histone H2A 8
- Description: histone H2A 8;(source:Araport11)
- TAIR Accession:
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0000037 — shoot axis apex — ápice del epiblasto (epiblastema) (Spanish, exact), シュート頂、茎頂 (Japanese, exact)
- PO:0008019 — leaf lamina base — base de la lámina de la hoja (Spanish, exact), 葉身基部 (Japanese, exact)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009006 — shoot system — sistema de epiblasto (epiblastema) (Spanish, exact), シュート系、苗条系 (Japanese, exact), Poaceae crown (related), shoot (related), thalli (related), thallus (related), tree crown (narrow)
- PO:0009009 — plant embryo — embrión (Spanish, exact), 植物胚 (Japanese, exact), germ (related), embryo (broad)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009031 — sepal — sépalo (Spanish, exact), がく片 (Japanese, exact)
- PO:0009046 — flower — flor (Spanish, exact), 花 (Japanese, exact), floret (related), Asteraceae floret (narrow), basal flower (narrow), double flower (narrow), hermaphrodite flower (narrow), monoclinous flower (narrow), perfect flower (narrow)
- PO:0009052 — inflorescence flower pedicel — 小花柄 (Japanese, related), pedicelo (Spanish, broad)
- PO:0020038 — petiole — pecíolo (Spanish, exact), 葉柄 (Japanese, exact)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
- PO:0020137 — leaf apex — ápice de la hoja (Spanish, exact), 葉先 (Japanese, exact), leaf lamina apex (narrow), phyllid apex (narrow)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
- PO:0000016 — lateral root primordium — portion of lateral root primordium tissue (exact), primordio de raíz lateral (Spanish, exact), 側根原基 (Japanese, exact)
- PO:0000229 — flower meristem — floral meristem (exact), mersitema floral (Spanish, exact), 花芽分裂組織 (Japanese, exact), floral apical meristem (related), Poaceae floret meristem (narrow), ear floret meristem (narrow), floret meristem (narrow), tassel floret meristem (narrow)
- PO:0006020 — lateral root apical meristem — meristema apical de la raíz lateral (Spanish, exact), 側根頂端分裂組織 (Japanese, exact), apical meristem of lateral root (related), lateral root meristem (related)
- PO:0006085 — root meristem — meristema de la raíz (Spanish, exact), 根分裂組織 (Japanese, exact), meristematic zone (related)
- PO:0005052 — plant callus — callo (Spanish, exact), portion of plant callus tissue (exact), 植物カルス (Japanese, exact), callus (broad)
Germplasm Phenotype:
- CS69073 — Shorter, thickened siliques; strong asymmetric curvature of developing siliques, reduced fertility. Additional novel phenotypes occur, but only rarely. Under LD conditions, phenotypes also include: greatly reduced rosette size and stature; mature plants are spindly and have trouble remaining upright. Under SD conditions, phenotypes also include: increased leaf serration and petiole length. The following phenotypes are more pronounced under SD, but exist under LD conditions: early flowering, increased number of flowers with extra petals.
Function-related keywords:
- shoot axis apex , leaf lamina base , root , shoot system , plant embryo , vascular leaf , sepal , flower , inflorescence flower pedicel , petiole , hypocotyl , leaf apex , collective leaf structure , lateral root primordium , flower meristem , lateral root apical meristem , root meristem , plant callus
Literature:
- Cell cycle-regulated gene expression in Arabidopsis. DOI: 10.1074/jbc.M207570200 ; PMID: 12169696
- Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. DOI: 10.1074/jbc.M308435200 ; PMID: 14576160
- DNA array analyses of Arabidopsis thaliana lacking a vacuolar Na+/H+ antiporter: impact of AtNHX1 on gene expression. DOI: 10.1111/j.1365-313X.2004.02253.x ; PMID: 15546358
- A transcriptome-based characterization of habituation in plant tissue culture. DOI: 10.1104/pp.105.076059 ; PMID: 16489130
- Locus-specific control of DNA methylation by the Arabidopsis SUVH5 histone methyltransferase. DOI: 10.1105/tpc.106.041400 ; PMID: 16582009
- Gene expression profiles of Arabidopsis Cvi seeds during dormancy cycling indicate a common underlying dormancy control mechanism. DOI: 10.1111/j.1365-313X.2006.02738.x ; PMID: 16709196
- Constitutive expression exposes functional redundancy between the Arabidopsis histone H2A gene HTA1 and other H2A gene family members. DOI: 10.1105/tpc.105.039719 ; PMID: 16751347
- BOLITA, an Arabidopsis AP2/ERF-like transcription factor that affects cell expansion and proliferation/differentiation pathways. DOI: 10.1007/s11103-006-9059-1 ; PMID: 17096212
- A diverse and evolutionarily fluid set of microRNAs in Arabidopsis thaliana. DOI: 10.1101/gad.1476406 ; PMID: 17182867
- Repression of flowering in Arabidopsis requires activation of FLOWERING LOCUS C expression by the histone variant H2A.Z. DOI: 10.1105/tpc.106.048447 ; PMID: 17220196
- Arabidopsis homologs of components of the SWR1 complex regulate flowering and plant development. DOI: 10.1242/dev.001891 ; PMID: 17470967
- Histone H2A.Z and homologues of components of the SWR1 complex are required to control immunity in Arabidopsis. DOI: 10.1111/j.1365-313X.2007.03361.x ; PMID: 17988222
- A genome-wide transcriptome profiling reveals the early molecular events during callus initiation in Arabidopsis multiple organs. DOI: 10.1016/j.ygeno.2012.05.013 ; PMID: 22664253
- Deposition of histone variant H2A.Z within gene bodies regulates responsive genes. DOI: 10.1371/journal.pgen.1002988 ; PMID: 23071449
- H2A.Z Represses Gene Expression by Modulating Promoter Nucleosome Structure and Enhancer Histone Modifications in Arabidopsis. DOI: 10.1016/j.molp.2017.09.007 ; PMID: 28951178
- H2A.Z Represses Gene Expression by Modulating Promoter Nucleosome Structure and Enhancer Histone Modifications in Arabidopsis. DOI: 10.1016/j.molp.2018.03.011 ; PMID: 29614313
- Epigenetic regulation of anthocyanin biosynthesis by an antagonistic interaction between H2A.Z and H3K4me3. DOI: 10.1111/nph.15306 ; PMID: 29959895
- Histone H2A variants confer specific properties to nucleosomes and impact on chromatin accessibility. DOI: 10.1093/nar/gky540 ; PMID: 29945241
- Arabidopsis YAF9 histone readers modulate flowering time through NuA4-complex-dependent H4 and H2A.Z histone acetylation at FLC chromatin. DOI: 10.1111/nph.15737 ; PMID: 30742710
- The histone variant H2A.Z and chromatin remodeler BRAHMA act coordinately and antagonistically to regulate transcription and nucleosome dynamics in Arabidopsis. DOI: 10.1111/tpj.14281 ; PMID: 30742338
- Powerdress as the novel regulator enhances Arabidopsis seeds germination tolerance to high temperature stress by histone modification of SOM locus. DOI: 10.1016/j.plantsci.2019.04.001 ; PMID: 31084884
- Epigenetic regulation of miR396 expression by SWR1-C and the effect of miR396 on leaf growth and developmental phase transition in Arabidopsis. DOI: 10.1093/jxb/erz285 ; PMID: 31198943
- Arabidopsis SWR1-associated protein methyl-CpG-binding domain 9 is required for histone H2A.Z deposition. DOI: 10.1038/s41467-019-11291-w ; PMID: 31350403
- Transposition favors the generation of large effect mutations that may facilitate rapid adaption. DOI: 10.1038/s41467-019-11385-5 ; PMID: 31366887
- Histone acetylation recruits the SWR1 complex to regulate active DNA demethylation in Arabidopsis. DOI: 10.1073/pnas.1906023116 ; PMID: 31363048
- Methyl-CpG-binding domain 9 (MBD9) is required for H2A.Z incorporation into chromatin at a subset of H2A.Z-enriched regions in the Arabidopsis genome. DOI: 10.1371/journal.pgen.1008326 ; PMID: 31381567
- Epigenetic silencing of a multifunctional plant stress regulator. DOI: 10.7554/eLife.47835 ; PMID: 31418686
- Roles of the INO80 and SWR1 Chromatin Remodeling Complexes in Plants. DOI: 10.3390/ijms20184591 ; PMID: 31533258
- The Evening Complex Establishes Repressive Chromatin Domains Via H2A.Z Deposition. DOI: 10.1104/pp.19.00881 ; PMID: 31712305
- HISTONE DEACETYLASE 9 stimulates auxin-dependent thermomorphogenesis in Arabidopsis thaliana by mediating H2A.Z depletion. DOI: 10.1073/pnas.1911694116 ; PMID: 31767749
- SWR1 Chromatin Remodeling Complex: A Key Transcriptional Regulator in Plants. DOI: 10.3390/cells8121621 ; PMID: 31842357
- A plant-specific SWR1 chromatin-remodeling complex couples histone H2A.Z deposition with nucleosome sliding. DOI: 10.15252/embj.2019102008 ; PMID: 32115743
- Insights Into the Function of the NuA4 Complex in Plants. DOI: 10.3389/fpls.2020.00125 ; PMID: 32153620
- NAP1-RELATED PROTEIN1 and 2 negatively regulate H2A.Z abundance in chromatin in Arabidopsis. DOI: 10.1038/s41467-020-16691-x ; PMID: 32513971
- The repressive role of Arabidopsis H2A.Z in transcriptional regulation depends on AtBMI1 activity. DOI: 10.1038/s41467-019-10773-1 ; PMID: 31249301
- A unified phylogeny-based nomenclature for histone variants. DOI: 10.1186/1756-8935-5-7 ; PMID: 22650316
- AtINO80 represses photomorphogenesis by modulating nucleosome density and H2A.Z incorporation in light-related genes. DOI: 10.1073/pnas.2001976117 ; PMID: 33318175
- H2A Variants in Arabidopsis: Versatile Regulators of Genome Activity. DOI: 10.1016/j.xplc.2019.100015 ; PMID: 33404536
- Arabidopsis cryptochrome 1 controls photomorphogenesis through regulation of H2A.Z deposition. DOI: 10.1093/plcell/koab091 ; PMID: 33768238
- NF-YCs modulate histone variant H2A.Z deposition to regulate photomorphogenic growth in Arabidopsis. DOI: 10.1111/jipb.13109 ; PMID: 33945672
- Phytochrome B interacts with SWC6 and ARP6 to regulate H2A.Z deposition and photomorphogensis in Arabidopsis. DOI: 10.1111/jipb.13111 ; PMID: 33982818
- Ectopic targeting of CG DNA methylation in Arabidopsis with the bacterial SssI methyltransferase. DOI: 10.1038/s41467-021-23346-y ; PMID: 34035251
- The INO80 chromatin remodeling complex promotes thermomorphogenesis by connecting H2A.Z eviction and active transcription in Arabidopsis. DOI: 10.1016/j.molp.2021.07.001 ; PMID: 34242850
- Cryptic promoter activation occurs by at least two different mechanisms in the Arabidopsis genome. DOI: 10.1111/tpj.15420 ; PMID: 34252235
- Genomic impact of stress-induced transposable element mobility in Arabidopsis. DOI: 10.1093/nar/gkab828 ; PMID: 34551439
- The histone variant H3.3 promotes the active chromatin state to repress flowering in Arabidopsis. DOI: 10.1093/plphys/kiab224 ; PMID: 34618105
- Arabidopsis OXIDATIVE STRESS 3 enhances stress tolerance in Schizosaccharomyces pombe by promoting histone subunit replacement that upregulates drug-resistant genes. DOI: 10.1093/genetics/iyab149 ; PMID: 34740252
- SDG2 regulates Arabidopsis inflorescence architecture through SWR1-ERECTA signaling pathway. DOI: 10.1016/j.isci.2021.103236 ; PMID: 34746701
- Phosphorylation of Histone H2A at Serine 95 Is Essential for Flowering Time and Development in Arabidopsis. DOI: 10.3389/fpls.2021.761008 ; PMID: 34887889
- NuA4 and H2A.Z control environmental responses and autotrophic growth in Arabidopsis. DOI: 10.1038/s41467-021-27882-5 ; PMID: 35022409
- Warm Temperature Promotes Shoot Regeneration in Arabidopsis thaliana. DOI: 10.1093/pcp/pcac017 ; PMID: 35157760
- The Arabidopsis DREAM complex antagonizes WDR5A to modulate histone H3K4me2/3 deposition for a subset of genome repression. DOI: 10.1073/pnas.2206075119 ; PMID: 35759663
- Feedback regulation of auxin signaling through the transcription of H2A.Z and deposition of H2A.Z to SMALL AUXIN UP RNAs in Arabidopsis. DOI: 10.1111/nph.18440 ; PMID: 36017638
- H2A.Z contributes to trithorax activity at the AGAMOUS locus. DOI: 10.1016/j.molp.2022.01.005 ; PMID: 35026437
- TFIIS Is Crucial During Early Transcript Elongation for Transcriptional Reprogramming in Response to Heat Stress. DOI: 10.1016/j.jmb.2022.167917 ; PMID: 36502880
- Loss-of-Function Mutation of ACTIN-RELATED PROTEIN 6 (ARP6) Impairs Root Growth in Response to Salinity Stress. DOI: 10.1007/s12033-023-00653-x ; PMID: 36627550
- Coordinated histone variant H2A.Z eviction and H3.3 deposition control plant thermomorphogenesis. DOI: 10.1111/nph.18738 ; PMID: 36647799
- Chromatin Remodeling Complex SWR1 Regulates Root Development by Affecting the Accumulation of Reactive Oxygen Species (ROS). DOI: 10.3390/plants12040940 ; PMID: 36840288
- The dynamics of H2A.Z on SMALL AUXIN UP RNAs regulate abscisic acid-auxin signaling crosstalk in Arabidopsis. DOI: 10.1093/jxb/erad131 ; PMID: 37022978
- The Arabidopsis Deubiquitylase OTU5 Suppresses Flowering by Histone Modification-Mediated Activation of the Major Flowering Repressors FLC, MAF4, and MAF5. DOI: 10.3390/ijms24076176 ; PMID: 37047144
- PIFs interact with SWI2/SNF2-related 1 complex subunit 6 to regulate H2A.Z deposition and photomorphogenesis in Arabidopsis. DOI: 10.1016/j.jgg.2023.04.008 ; PMID: 37120038
- Histone chaperones AtChz1A and AtChz1B are required for H2A.Z deposition and interact with the SWR1 chromatin-remodeling complex in Arabidopsis thaliana. DOI: 10.1111/nph.18940 ; PMID: 37129076
- H3K36me3 and H2A.Z coordinately modulate flowering time in Arabidopsis. DOI: 10.1016/j.jgg.2023.05.012 ; PMID: 37302474
- Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions. DOI: 10.1091/mbc.e04-09-0791 ; PMID: 15496452
- Arabidopsis homologs of components of the SWR1 complex regulate flowering and plant development. DOI: 10.1242/dev.001891 ; PMID: 17470967
- Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions. DOI: 10.1091/mbc.e04-09-0791 ; PMID: 15496452
- Arabidopsis homologs of components of the SWR1 complex regulate flowering and plant development. DOI: 10.1242/dev.001891 ; PMID: 17470967
- Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions. DOI: 10.1091/mbc.e04-09-0791 ; PMID: 15496452
- Arabidopsis homologs of components of the SWR1 complex regulate flowering and plant development. DOI: 10.1242/dev.001891 ; PMID: 17470967
Sequence:
cDNA Sequence
- >AT2G38810.2 ATCCCGCTCTCGTTTTCAGGTACTTCCCTCTCTGAGCTAGGGTTTTAATTCGACGTCTCTCTTTTGTCTCTGTATCGATTTTCTCGCCGCGAATTTCGAATAGATATGGCTGGTAAAGGTGGGAAAGGGCTTCTAGCTGCGAAGACGACGGCAGCAGCTGCAAACAAAGACAGTGTTAAGAAGAAATCCATCTCTCGCTCTTCTCGTGCTGGTATTCAGTTTCCAGTGGGTCGTATTCATCGTCAACTCAAGCAAAGAGTTTCAGCACATGGAAGAGTTGGTGCCACTGCTGCTGTTTACACTGCATCAATTCTAGAATACTTGACTGCTGAAGTACTCGAGTTAGCTGGAAATGCGAGCAAGGATCTCAAAGTGAAGAGAATTACACCAAGACATTTGCAGCTTGCAATCAGAGGAGATGAGGAACTTGACACTCTCATCAAAGGAACCATTGCAGGAGGAGGTGTGATCCCTCACATCCACAAGTCCCTTGTCAACAAAGTCACCAAGGATTGAGTTTCGCTCTCTGAGTCCTAAGTCTCTATTATACTATGTGCTCTTTTCTAGACGCCCTCATGTGTATATGGGTTCATTGTATCTCTTAGGTCTCTCGTTTTAGACTCATACTCTTGTTATTTTGCTAATGCTTACATGATTGAGGATGATGGTTCTTGCTTTCTTGGTTTCCTAT
- >AT2G38810.3 ATCCCGCTCTCGTTTTCAGGTACTTCCCTCTCTGAGCTAGGGTTTTAATTCGACGTCTCTCTTTTGTCTCTGTATCGATTTTCTCGCCGCGAATTTCGAATAGATATGGCTGGTAAAGGTGGGAAAGGGCTTCTAGCTGCGAAGACGACGGCAGCAGCTGCAAACAAAGACAGTGTTAAGAAGAAATCCATCTCTCGCTCTTCTCGTGCTGGTATTCAGTTTCCAGTGGGTCGTATTCATCGTCAACTCAAGCAAAGAGTTTCAGCACATGGAAGAGTTGGTGCCACTGCTGCTGTTTACACTGCATCAATTCTAGAATACTTGACTGCTGAAGTACTCGAGTTAGCTGGAAATGCGAGCAAGGATCTCAAAGTGAAGAGAATTACACCAAGACATTTGCAGCTTGCAATCAGAGGAGATGAGGAACTTGACACTCTCATCAAAGGAACCATTGCAGGAGGAGGTGTGATCCCTCACATCCACAAGTCCCTTGTCAACAAAGTCACCAAGGATTGAGTTTCGCTCTCTGAGTCCTAAGTCTCTATTATACTATGTGCTCTTTTCTAGACGCCCTCATGTGTATATGGGTTCATTGTATCTCTTAGGTCTCTCGTTTTAGACTCATACTCTTGTTATTTTGCTAATGCTTACATGATTGAGGATGATGGTTCTTGCTTTCTTGGTTTCCTAT
- >AT2G38810.4 ATCCCGCTCTCGTTTTCAGGTACTTCCCTCTCTGAGCTAGGGTTTTAATTCGACGTCTCTCTTTTGTCTCTGTATCGATTTTCTCGCCGCGAATTTCGAATAGATATGGCTGGTAAAGGTGGGAAAGGGCTTCTAGCTGCGAAGACGACGGCAGCAGCTGCAAACAAAGACAGTGTTAAGAAGAAATCCATCTCTCGCTCTTCTCGTGCTGGTATTCAGTTTCCAGTGGGTCGTATTCATCGTCAACTCAAGCAAAGAGTTTCAGCACATGGAAGAGTTGGTGCCACTGCTGCTGTTTACACTGCATCAATTCTAGAATACTTGACTGCTGAAGTACTCGAGTTAGCTGGAAATGCGAGCAAGGATCTCAAAGTGAAGAGAATTACACCAAGACATTTGCAGCTTGCAATCAGAGGAGATGAGGAACTTGACACTCTCATCAAAGGAACCATTGCAGGAGGAGGTGTGATCCCTCACATCCACAAGTCCCTTGTCAACAAAGTCACCAAGGATTGAGTTTCGCTCTCTGAGTCCTAAGTCTCTATTATACTATGTGCTCTTTTCTAGACGCCCTCATGTGTATATGGGTTCATTGTATCTCTTAGGTCTCTCGTTTTAGACTCATACTCTTGTTATTTTGCTAATGCTTACATGATTGAGGATGATGGTTCTTGCTTTCTTGGTTTCCTAT
- >AT2G38810.1 ATCCCGCTCTCGTTTTCAGGTACTTCCCTCTCTGAGCTAGGGTTTTAATTCGACGTCTCTCTTTTGTCTCTGTATCGATTTTCTCGCCGCGAATTTCGAATAGATATGGCTGGTAAAGGTGGGAAAGGGCTTCTAGCTGCGAAGACGACGGCAGCAGCTGCAAACAAAGACAGTGTTAAGAAGAAATCCATCTCTCGCTCTTCTCGTGCTGGTATTCAGTTTCCAGTGGGTCGTATTCATCGTCAACTCAAGCAAAGAGTTTCAGCACATGGAAGAGTTGGTGCCACTGCTGCTGTTTACACTGCATCAATTCTAGAATACTTGACTGCTGAAGTACTCGAGTTAGCTGGAAATGCGAGCAAGGATCTCAAAGTGAAGAGAATTACACCAAGACATTTGCAGCTTGCAATCAGAGGAGATGAGGAACTTGACACTCTCATCAAAGGAACCATTGCAGGAGGAGGTGTGATCCCTCACATCCACAAGTCCCTTGTCAACAAAGTCACCAAGGATTGAGTTTCGCTCTCTGAGTCCTAAGTCTCTATTATACTATGTGCTCTTTTCTAGACGCCCTCATGTGTATATGGGTTCATTGTATCTCTTAGGTCTCTCGTTTTAGACTCATACTCTTGTTATTTTGCTAATGCTTACATGATTGAGGATGATGGTTCTTGCTTTCTTGGTTTCCTAT
CDS Sequence
- >AT2G38810.2 ATGGCTGGTAAAGGTGGGAAAGGGCTTCTAGCTGCGAAGACGACGGCAGCAGCTGCAAACAAAGACAGTGTTAAGAAGAAATCCATCTCTCGCTCTTCTCGTGCTGGTATTCAGTTTCCAGTGGGTCGTATTCATCGTCAACTCAAGCAAAGAGTTTCAGCACATGGAAGAGTTGGTGCCACTGCTGCTGTTTACACTGCATCAATTCTAGAATACTTGACTGCTGAAGTACTCGAGTTAGCTGGAAATGCGAGCAAGGATCTCAAAGTGAAGAGAATTACACCAAGACATTTGCAGCTTGCAATCAGAGGAGATGAGGAACTTGACACTCTCATCAAAGGAACCATTGCAGGAGGAGGTGTGATCCCTCACATCCACAAGTCCCTTGTCAACAAAGTCACCAAGGATTGA
- >AT2G38810.3 ATGGCTGGTAAAGGTGGGAAAGGGCTTCTAGCTGCGAAGACGACGGCAGCAGCTGCAAACAAAGACAGTGTTAAGAAGAAATCCATCTCTCGCTCTTCTCGTGCTGGTATTCAGTTTCCAGTGGGTCGTATTCATCGTCAACTCAAGCAAAGAGTTTCAGCACATGGAAGAGTTGGTGCCACTGCTGCTGTTTACACTGCATCAATTCTAGAATACTTGACTGCTGAAGTACTCGAGTTAGCTGGAAATGCGAGCAAGGATCTCAAAGTGAAGAGAATTACACCAAGACATTTGCAGCTTGCAATCAGAGGAGATGAGGAACTTGACACTCTCATCAAAGGAACCATTGCAGGAGGAGGTGTGATCCCTCACATCCACAAGTCCCTTGTCAACAAAGTCACCAAGGATTGA
- >AT2G38810.4 ATGGCTGGTAAAGGTGGGAAAGGGCTTCTAGCTGCGAAGACGACGGCAGCAGCTGCAAACAAAGACAGTGTTAAGAAGAAATCCATCTCTCGCTCTTCTCGTGCTGGTATTCAGTTTCCAGTGGGTCGTATTCATCGTCAACTCAAGCAAAGAGTTTCAGCACATGGAAGAGTTGGTGCCACTGCTGCTGTTTACACTGCATCAATTCTAGAATACTTGACTGCTGAAGTACTCGAGTTAGCTGGAAATGCGAGCAAGGATCTCAAAGTGAAGAGAATTACACCAAGACATTTGCAGCTTGCAATCAGAGGAGATGAGGAACTTGACACTCTCATCAAAGGAACCATTGCAGGAGGAGGTGTGATCCCTCACATCCACAAGTCCCTTGTCAACAAAGTCACCAAGGATTGA
- >AT2G38810.1 ATGGCTGGTAAAGGTGGGAAAGGGCTTCTAGCTGCGAAGACGACGGCAGCAGCTGCAAACAAAGACAGTGTTAAGAAGAAATCCATCTCTCGCTCTTCTCGTGCTGGTATTCAGTTTCCAGTGGGTCGTATTCATCGTCAACTCAAGCAAAGAGTTTCAGCACATGGAAGAGTTGGTGCCACTGCTGCTGTTTACACTGCATCAATTCTAGAATACTTGACTGCTGAAGTACTCGAGTTAGCTGGAAATGCGAGCAAGGATCTCAAAGTGAAGAGAATTACACCAAGACATTTGCAGCTTGCAATCAGAGGAGATGAGGAACTTGACACTCTCATCAAAGGAACCATTGCAGGAGGAGGTGTGATCCCTCACATCCACAAGTCCCTTGTCAACAAAGTCACCAAGGATTGA
Protein Sequence
- >AT2G38810.2 MAGKGGKGLLAAKTTAAAANKDSVKKKSISRSSRAGIQFPVGRIHRQLKQRVSAHGRVGATAAVYTASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLVNKVTKD
- >AT2G38810.3 MAGKGGKGLLAAKTTAAAANKDSVKKKSISRSSRAGIQFPVGRIHRQLKQRVSAHGRVGATAAVYTASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLVNKVTKD
- >AT2G38810.4 MAGKGGKGLLAAKTTAAAANKDSVKKKSISRSSRAGIQFPVGRIHRQLKQRVSAHGRVGATAAVYTASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLVNKVTKD
- >AT2G38810.1 MAGKGGKGLLAAKTTAAAANKDSVKKKSISRSSRAGIQFPVGRIHRQLKQRVSAHGRVGATAAVYTASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLVNKVTKD