Gene Details:
- Gene ID: AT2G43570
- Gene Symbol: CHI
- Gene Name: chitinase, putative
- Description: chitinase;(source:Araport11)
- TAIR Accession: locus:2044024
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0008019 — leaf lamina base — base de la lámina de la hoja (Spanish, exact), 葉身基部 (Japanese, exact)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009009 — plant embryo — embrión (Spanish, exact), 植物胚 (Japanese, exact), germ (related), embryo (broad)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009029 — stamen — estambre (Spanish, exact), 雄蕊 (Japanese, exact), Poaceae stamen (narrow), Zea stamen (narrow)
- PO:0009031 — sepal — sépalo (Spanish, exact), がく片 (Japanese, exact)
- PO:0020030 — cotyledon — cotiledón (Spanish, exact), seed leaf (exact), 子葉 (Japanese, exact)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
Gene Ontology:
- GO:0009627 — acts upstream of or within — systemic acquired resistance
- GO:0099503 — located in — secretory vesicle
- GO:0072722 — involved in — response to amitrole
- GO:0016998 — involved in — cell wall macromolecule catabolic process
- GO:0010150 — involved in — leaf senescence
- GO:0010272 — involved in — response to silver ion
- GO:0009615 — involved in — response to virus
- GO:0005576 — located in — extracellular region
- GO:0004568 — enables — chitinase activity
- GO:0048046 — located in — apoplast
Function-related keywords:
- leaf lamina base , root , plant embryo , vascular leaf , stamen , sepal , cotyledon , hypocotyl , collective leaf structure
Literature:
- Expression pattern of the Arabidopsis thaliana AtEP3/AtchitIV endochitinase gene. DOI: 10.1007/s004250000464 ; PMID: 11525512
- Arabidopsis transcriptome profiling indicates that multiple regulatory pathways are activated during cold acclimation in addition to the CBF cold response pathway. DOI: 10.1105/tpc.003483 ; PMID: 12172015
- Cell cycle-regulated gene expression in Arabidopsis. DOI: 10.1074/jbc.M207570200 ; PMID: 12169696
- An Arabidopsis mitogen-activated protein kinase kinase kinase gene family encodes essential positive regulators of cytokinesis. DOI: 10.1105/tpc.001164 ; PMID: 12034900
- Diverse RNA viruses elicit the expression of common sets of genes in susceptible Arabidopsis thaliana plants. DOI: 10.1046/j.1365-313x.2003.01625.x ; PMID: 12535341
- Leaf vitamin C contents modulate plant defense transcripts and regulate genes that control development through hormone signaling. DOI: 10.1105/tpc.010538 ; PMID: 12671089
- Loss of a callose synthase results in salicylic acid-dependent disease resistance. DOI: 10.1126/science.1086716 ; PMID: 12920300
- Expression of senescence-enhanced genes in response to oxidative stress. DOI: 10.1093/jxb/erg267 ; PMID: 12947053
- Transcriptome analysis of O3-exposed Arabidopsis reveals that multiple signal pathways act mutually antagonistically to induce gene expression. DOI: 10.1023/B:PLAN.0000019064.55734.52 ; PMID: 15010611
- Changes in gene expression in response to altered SHL transcript levels. DOI: 10.1023/B:PLAN.0000023661.65248.4b ; PMID: 15082927
- When defense pathways collide. The response of Arabidopsis to a combination of drought and heat stress. DOI: 10.1104/pp.103.033431 ; PMID: 15047901
- The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis. DOI: 10.1038/sj.emboj.7600337 ; PMID: 15282545
- Comparative genomics in salt tolerance between Arabidopsis and aRabidopsis-related halophyte salt cress using Arabidopsis microarray. DOI: 10.1104/pp.104.039909 ; PMID: 15247402
- Evidence for a direct link between glutathione biosynthesis and stress defense gene expression in Arabidopsis. DOI: 10.1105/tpc.104.022608 ; PMID: 15308753
- Genes commonly regulated by water-deficit stress in Arabidopsis thaliana. DOI: 10.1093/jxb/erh270 ; PMID: 15448178
- Cesium toxicity in Arabidopsis. DOI: 10.1104/pp.104.046672 ; PMID: 15489280
- Caesium-affected gene expression in Arabidopsis thaliana. DOI: 10.1111/j.1469-8137.2004.01282.x ; PMID: 15720685
- Drought tolerance established by enhanced expression of the CC-NBS-LRR gene, ADR1, requires salicylic acid, EDS1 and ABI1. DOI: 10.1111/j.1365-313X.2004.02086.x ; PMID: 15144382
- The WRKY70 transcription factor: a node of convergence for jasmonate-mediated and salicylate-mediated signals in plant defense. DOI: 10.1105/tpc.016980 ; PMID: 14742872
- The MAP kinase substrate MKS1 is a regulator of plant defense responses. DOI: 10.1038/sj.emboj.7600737 ; PMID: 15990873
- Expressed sequence tags from the Yukon ecotype of Thellungiella reveal that gene expression in response to cold, drought and salinity shows little overlap. DOI: 10.1007/s11103-005-6163-6 ; PMID: 16021339
- A transcriptome-based characterization of habituation in plant tissue culture. DOI: 10.1104/pp.105.076059 ; PMID: 16489130
- Arabidopsis PEN3/PDR8, an ATP binding cassette transporter, contributes to nonhost resistance to inappropriate pathogens that enter by direct penetration. DOI: 10.1105/tpc.105.038372 ; PMID: 16473969
- A comprehensive structure-function analysis of Arabidopsis SNI1 defines essential regions and transcriptional repressor activity. DOI: 10.1105/tpc.105.039677 ; PMID: 16766691
- Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. DOI: 10.1104/pp.106.082289 ; PMID: 16920880
- Oviposition by pierid butterflies triggers defense responses in Arabidopsis. DOI: 10.1104/pp.106.090837 ; PMID: 17142483
- Genetic variation suggests interaction between cold acclimation and metabolic regulation of leaf senescence. DOI: 10.1104/pp.106.091355 ; PMID: 17098848
- Phytotoxicity and innate immune responses induced by Nep1-like proteins. DOI: 10.1105/tpc.106.044180 ; PMID: 17194768
- Suppression by ABA of salicylic acid and lignin accumulation and the expression of multiple genes, in Arabidopsis infected with Pseudomonas syringae pv. tomato. DOI: 10.1007/s10142-006-0041-4 ; PMID: 17149585
- Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development. DOI: 10.1105/tpc.106.047688 ; PMID: 17337630
- Dual regulation role of GH3.5 in salicylic acid and auxin signaling during Arabidopsis-Pseudomonas syringae interaction. DOI: 10.1104/pp.107.106021 ; PMID: 17704230
- A comparison of leaf and petal senescence in wallflower reveals common and distinct patterns of gene expression and physiology. DOI: 10.1104/pp.108.120402 ; PMID: 18539778
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- The Arabidopsis NFYA5 transcription factor is regulated transcriptionally and posttranscriptionally to promote drought resistance. DOI: 10.1105/tpc.108.059444 ; PMID: 18682547
- Thaxtomin A affects CESA-complex density, expression of cell wall genes, cell wall composition, and causes ectopic lignification in Arabidopsis thaliana seedlings. DOI: 10.1093/jxb/ern344 ; PMID: 19269997
- An in vivo expression system for the identification of cargo proteins of vacuolar sorting receptors in Arabidopsis culture cells. DOI: 10.1111/tpj.12257 ; PMID: 23738689
- Transcriptional dynamics of two seed compartments with opposing roles in Arabidopsis seed germination. DOI: 10.1104/pp.113.223511 ; PMID: 23858430
- Contrasting Roles of the Apoplastic Aspartyl Protease APOPLASTIC, ENHANCED DISEASE SUSCEPTIBILITY1-DEPENDENT1 and LEGUME LECTIN-LIKE PROTEIN1 in Arabidopsis Systemic Acquired Resistance. DOI: 10.1104/pp.114.239665 ; PMID: 24755512
- Genome-Wide Screening for Lectin Motifs in Arabidopsis thaliana. DOI: 10.3835/plantgenome2017.02.0010 ; PMID: 28724081
- Enhanced Arabidopsis disease resistance against Botrytis cinerea induced by sulfur dioxide. DOI: 10.1016/j.ecoenv.2017.09.011 ; PMID: 28917191
- A sub-proteome of Arabidopsis thaliana mature stems trapped on Concanavalin A is enriched in cell wall glycoside hydrolases. DOI: 10.1093/jxb/erm082 ; PMID: 17526915
- Identification of genes expressed in vascular tissues using NPA-induced vascular overgrowth in Arabidopsis. DOI: 10.1093/pcp/pcn023 ; PMID: 18296723
- Hydroponic isotope labelling of entire plants (HILEP) for quantitative plant proteomics; an oxidative stress case study. DOI: 10.1016/j.phytochem.2008.04.007 ; PMID: 18538804
- Analysis of protein complexes in Arabidopsis leaves using size exclusion chromatography and label-free protein correlation profiling. DOI: 10.1016/j.jprot.2017.06.004 ; PMID: 28627464
Sequence:
cDNA Sequence
- >AT2G43570.1 TCACGGATCCATCATCATCTATAAAACACGAAGCTAATGTTCATCATCTCTCTCTGCAGTCTGCATCACAGACACAAAAACAATGGCTAAACCCACATCACGAAATGACCGATTTGCCCTTTTCTTCATAACCCTAATTTTCCTGATCCTAACCGTTTCCAAACCGGTCGCCTCTCAAAACTGTGGCTGCGCCTCTGACTTCTGTTGCAGCAAATATGGCTACTGTGGTACGACCGATGAGTTCTGCGGCGAGGGCTGCCAGGCAGGACCTTGCCGGAGCAGTGGAGGCGGTGGAGATCCTGCTGTTTCACTAGAAGGAACGGTGACACCTGACTTCTTTAACTCTATACTAAACCAAAGAGGTGATTGTCCTGGCAAAGGATTCTACACTCACGACACCTTCATGGCCGCAGCTAATTCTTACCCTAGCTTCGGTGCTTCCATCTCCAAACGCGAAATCGCGGCGTTTTTCGCTCACGTAGCCCAAGAAACAGGGTTCATGTGTTACATTGAGGAAATTGATGGACCAGCCAAGGCCGCATCCGGAGAGTACTGCGACACAGAGAAACCAGAGTTCCCATGTGCACAAGGAAAGGGCTACTATGGCCGTGGTGCAATCCAGCTCTCTTGGAACTACAACTACGGTCTCTGTGGCAAAGCCTTGGACGAGAACTTATTGGCTTCACCAGAGAAAGTTGCTCAAGACCAGGTTCTTGCCTTCAAGACCGCTTTCTGGTTCTGGACCACTAATGTTCGCACGAGTTTTAAATCGGGCTTTGGCGCAACAATCAGGGCAGTGAATAGTAGGGAGTGTAGCGGAGGAGATTCTACAGCCAAAGCCGCCAACAGGATTAAGTATTTCCAAGACTATTGTGGCAAGCTTGGAGTTGCACCTGGAGATAACCTCACTTGTTAAAGTTTCCTTGCTATCCATCCGAAACACAACTAGTGTTTGAAAAACTTAGAGATCACATAAGAGAAAGTATCATATTAGTATAATAATGTTGTAATACTTCACATTTTACCAAAAATAATAATAATAATGTTGTAATAGCTAGTGTCAATAAACGATTTCTTATGCATAGGCACGGCGGATTTTACAACAAAGGGCCGATGTGTAAAAAGAAAACACCCAATAG
CDS Sequence
- >AT2G43570.1 ATGGCTAAACCCACATCACGAAATGACCGATTTGCCCTTTTCTTCATAACCCTAATTTTCCTGATCCTAACCGTTTCCAAACCGGTCGCCTCTCAAAACTGTGGCTGCGCCTCTGACTTCTGTTGCAGCAAATATGGCTACTGTGGTACGACCGATGAGTTCTGCGGCGAGGGCTGCCAGGCAGGACCTTGCCGGAGCAGTGGAGGCGGTGGAGATCCTGCTGTTTCACTAGAAGGAACGGTGACACCTGACTTCTTTAACTCTATACTAAACCAAAGAGGTGATTGTCCTGGCAAAGGATTCTACACTCACGACACCTTCATGGCCGCAGCTAATTCTTACCCTAGCTTCGGTGCTTCCATCTCCAAACGCGAAATCGCGGCGTTTTTCGCTCACGTAGCCCAAGAAACAGGGTTCATGTGTTACATTGAGGAAATTGATGGACCAGCCAAGGCCGCATCCGGAGAGTACTGCGACACAGAGAAACCAGAGTTCCCATGTGCACAAGGAAAGGGCTACTATGGCCGTGGTGCAATCCAGCTCTCTTGGAACTACAACTACGGTCTCTGTGGCAAAGCCTTGGACGAGAACTTATTGGCTTCACCAGAGAAAGTTGCTCAAGACCAGGTTCTTGCCTTCAAGACCGCTTTCTGGTTCTGGACCACTAATGTTCGCACGAGTTTTAAATCGGGCTTTGGCGCAACAATCAGGGCAGTGAATAGTAGGGAGTGTAGCGGAGGAGATTCTACAGCCAAAGCCGCCAACAGGATTAAGTATTTCCAAGACTATTGTGGCAAGCTTGGAGTTGCACCTGGAGATAACCTCACTTGTTAA
Protein Sequence
- >AT2G43570.1 MAKPTSRNDRFALFFITLIFLILTVSKPVASQNCGCASDFCCSKYGYCGTTDEFCGEGCQAGPCRSSGGGGDPAVSLEGTVTPDFFNSILNQRGDCPGKGFYTHDTFMAAANSYPSFGASISKREIAAFFAHVAQETGFMCYIEEIDGPAKAASGEYCDTEKPEFPCAQGKGYYGRGAIQLSWNYNYGLCGKALDENLLASPEKVAQDQVLAFKTAFWFWTTNVRTSFKSGFGATIRAVNSRECSGGDSTAKAANRIKYFQDYCGKLGVAPGDNLTC