Gene Details:
- Gene ID: AT3G06420
- Gene Symbol: ATG8H
- Gene Name: autophagy 8h
- Description: Ubiquitin-like superfamily protein;(source:Araport11)
- TAIR Accession:
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0025195 — pollen tube cell — célula del tubo polínico (Spanish, exact), 花粉管細胞 (Japanese, exact)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
Function-related keywords:
Literature:
- Leaf senescence and starvation-induced chlorosis are accelerated by the disruption of an Arabidopsis autophagy gene. DOI: 10.1104/pp.011024 ; PMID: 12114572
- Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures. DOI: 10.1104/pp.104.039370 ; PMID: 15235117
- Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation. DOI: 10.1104/pp.104.044362 ; PMID: 15310832
- Processing of ATG8s, ubiquitin-like proteins, and their deconjugation by ATG4s are essential for plant autophagy. DOI: 10.1105/tpc.104.025395 ; PMID: 15494556
- Autophagic nutrient recycling in Arabidopsis directed by the ATG8 and ATG12 conjugation pathways. DOI: 10.1104/pp.105.060673 ; PMID: 16040659
- Starvation-induced expression of autophagy-related genes in Arabidopsis. DOI: 10.1042/BC20040516 ; PMID: 16354162
- Genome-wide interacting effects of sucrose and herbicide-mediated stress in Arabidopsis thaliana: novel insights into atrazine toxicity and sucrose-induced tolerance. DOI: 10.1186/1471-2164-8-450 ; PMID: 18053238
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. DOI: 10.1104/pp.108.126375 ; PMID: 18775970
- An autophagy-associated Atg8 protein is involved in the responses of Arabidopsis seedlings to hormonal controls and abiotic stresses. DOI: 10.1093/jxb/ern244 ; PMID: 18836138
- Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana. DOI: 10.1093/molbev/msq204 ; PMID: 20736450
- ATI1, a newly identified atg8-interacting protein, binds two different Atg8 homologs. DOI: 10.4161/psb.20030 ; PMID: 22580699
- The deubiquitinating enzyme AMSH1 and the ESCRT-III subunit VPS2.1 are required for autophagic degradation in Arabidopsis. DOI: 10.1105/tpc.113.113399 ; PMID: 23800962
- ATG8-Binding UIM Proteins Define a New Class of Autophagy Adaptors and Receptors. DOI: 10.1016/j.cell.2019.02.009 ; PMID: 30955882
- Cadmium induces reactive oxygen species-dependent pexophagy in Arabidopsis leaves. DOI: 10.1111/pce.13597 ; PMID: 31152467
- Phytopathogen Effectors Use Multiple Mechanisms to Manipulate Plant Autophagy. DOI: 10.1016/j.chom.2020.07.010 ; PMID: 32810441
- C53 is a cross-kingdom conserved reticulophagy receptor that bridges the gap betweenselective autophagy and ribosome stalling at the endoplasmic reticulum. DOI: 10.1080/15548627.2020.1846304 ; PMID: 33164651
- Thermopriming-Induced Autophagy in Shoot Apical Meristem of Arabidopsis. DOI: 10.30498/ijb.2021.253616.2901 ; PMID: 35350643
Sequence:
cDNA Sequence
- >AT3G06420.1 GTTTCTTCTCGAACAATCAAAAACGAACTAACCAAACATAAAATTGAACACATCCTCTTCCTCTGCTCTCTGCAAACAAAAAAACACCGATTCGGTCAGGAATCATTCGTCGTGAAATCTGTAATGGGGATTGTTGTCAAGTCTTTCAAGGATCAATTCTCCTCTGATGAGAGATTGAAGGAGTCGAACAACATCATTGCGAAATATCCAGATAGAATACCTGTGATCATTGAGAAATATTCAAACGCAGATCTGCCAGACATGGAGAAGAACAAATACTTGGTCCCACGAGACATGACTGTTGGACATTTCATCCATATGCTAAGCAAAAGGATGCAGTTAGATCCATCCAAAGCTCTCTTTGTTTTCGTACACAACACTCTTCCTCAAACCGCTAGTCGCATGGACTCTCTCTACAATACTTTCAAGGAAGAAGACGGGTTCTTGTACATGTGCTACAGCACCGAGAAAACTTTCGGCTAACAAAAGATTTGTCGCTTCATATCGAAATCGAAGCGCACTCTGAATAATCCATTTGTTTGATTCCTATGTTTGTGAATAACGTCAGCTCTTGTTGTTACTGTTATTGTTGTTGTTAGCTGACATTGTACAGAAAAGCTAAAAAAAAGAAAGACATTTGACTTTGTAAATTATGTATAATCCAACTATGGCAATAATAATAAGACCAAGTGATGATGATTCACACGAAACT
CDS Sequence
- >AT3G06420.1 ATGGGGATTGTTGTCAAGTCTTTCAAGGATCAATTCTCCTCTGATGAGAGATTGAAGGAGTCGAACAACATCATTGCGAAATATCCAGATAGAATACCTGTGATCATTGAGAAATATTCAAACGCAGATCTGCCAGACATGGAGAAGAACAAATACTTGGTCCCACGAGACATGACTGTTGGACATTTCATCCATATGCTAAGCAAAAGGATGCAGTTAGATCCATCCAAAGCTCTCTTTGTTTTCGTACACAACACTCTTCCTCAAACCGCTAGTCGCATGGACTCTCTCTACAATACTTTCAAGGAAGAAGACGGGTTCTTGTACATGTGCTACAGCACCGAGAAAACTTTCGGCTAA
Protein Sequence
- >AT3G06420.1 MGIVVKSFKDQFSSDERLKESNNIIAKYPDRIPVIIEKYSNADLPDMEKNKYLVPRDMTVGHFIHMLSKRMQLDPSKALFVFVHNTLPQTASRMDSLYNTFKEEDGFLYMCYSTEKTFG