Gene Details:
- Gene ID: AT3G10920
- Gene Symbol: ATMSD1, AtSOD1, MEE33, MSD1
- Gene Name: ARABIDOPSIS MANGANESE SUPEROXIDE DISMUTASE 1, superoxide dismutase 1, MATERNAL EFFECT EMBRYO ARREST 33, manganese superoxide dismutase 1
- Description: manganese superoxide dismutase 1;(source:Araport11)
- TAIR Accession: locus:2085552
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0000037 — shoot axis apex — ápice del epiblasto (epiblastema) (Spanish, exact), シュート頂、茎頂 (Japanese, exact)
- PO:0008019 — leaf lamina base — base de la lámina de la hoja (Spanish, exact), 葉身基部 (Japanese, exact)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009006 — shoot system — sistema de epiblasto (epiblastema) (Spanish, exact), シュート系、苗条系 (Japanese, exact), Poaceae crown (related), shoot (related), thalli (related), thallus (related), tree crown (narrow)
- PO:0009009 — plant embryo — embrión (Spanish, exact), 植物胚 (Japanese, exact), germ (related), embryo (broad)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009029 — stamen — estambre (Spanish, exact), 雄蕊 (Japanese, exact), Poaceae stamen (narrow), Zea stamen (narrow)
- PO:0009031 — sepal — sépalo (Spanish, exact), がく片 (Japanese, exact)
- PO:0009046 — flower — flor (Spanish, exact), 花 (Japanese, exact), floret (related), Asteraceae floret (narrow), basal flower (narrow), double flower (narrow), hermaphrodite flower (narrow), monoclinous flower (narrow), perfect flower (narrow)
- PO:0009052 — inflorescence flower pedicel — 小花柄 (Japanese, related), pedicelo (Spanish, broad)
- PO:0020030 — cotyledon — cotiledón (Spanish, exact), seed leaf (exact), 子葉 (Japanese, exact)
- PO:0020038 — petiole — pecíolo (Spanish, exact), 葉柄 (Japanese, exact)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
- PO:0020137 — leaf apex — ápice de la hoja (Spanish, exact), 葉先 (Japanese, exact), leaf lamina apex (narrow), phyllid apex (narrow)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
Gene Ontology:
- GO:0019430 — acts upstream of or within — removal of superoxide radicals
- GO:0009793 — acts upstream of or within — embryo development ending in seed dormancy
- GO:0030145 — enables — manganese ion binding
- GO:0005739 — located in — mitochondrion
- GO:0004784 — enables — superoxide dismutase activity
- GO:0046872 — enables — metal ion binding
- GO:0010043 — acts upstream of or within — response to zinc ion
- GO:0005829 — located in — cytosol
- GO:0005739 — is active in — mitochondrion
- GO:0005507 — enables — copper ion binding
Function-related keywords:
- shoot axis apex , leaf lamina base , root , shoot system , plant embryo , vascular leaf , stamen , sepal , flower , inflorescence flower pedicel , cotyledon , petiole , hypocotyl , leaf apex , collective leaf structure , pollen , pollen
Literature:
- Superoxide dismutase in Arabidopsis: an eclectic enzyme family with disparate regulation and protein localization. DOI: 10.1104/pp.118.2.637 ; PMID: 9765550
- Analysis of the Arabidopsis mitochondrial proteome. DOI: 6919 ; PMID: 11743115
- Proteomic identification of divalent metal cation binding proteins in plant mitochondria. DOI: 10.1016/s0014-5793(03)00101-7 ; PMID: 12606038
- New insights into the respiratory chain of plant mitochondria. Supercomplexes and a unique composition of complex II. DOI: 10.1104/pp.103.024620 ; PMID: 12970493
- Experimental analysis of the Arabidopsis mitochondrial proteome highlights signaling and regulatory components, provides assessment of targeting prediction programs, and indicates plant-specific mitochondrial proteins. DOI: 10.1105/tpc.016055 ; PMID: 14671022
- A methyl viologen-resistant mutant of Arabidopsis, which is allelic to ozone-sensitive rcd1, is tolerant to supplemental ultraviolet-B irradiation. DOI: 10.1104/pp.103.033480 ; PMID: 14657410
- A proteomic analysis of plant programmed cell death. DOI: 10.1016/j.phytochem.2004.04.020 ; PMID: 15276441
- Evidence for a direct link between glutathione biosynthesis and stress defense gene expression in Arabidopsis. DOI: 10.1105/tpc.104.022608 ; PMID: 15308753
- The mitochondrial type II peroxiredoxin F is essential for redox homeostasis and root growth of Arabidopsis thaliana under stress. DOI: 10.1074/jbc.M413189200 ; PMID: 15632145
- Genetic and molecular identification of genes required for female gametophyte development and function in Arabidopsis. DOI: 10.1242/dev.01595 ; PMID: 15634699
- A proteomic approach to apoplastic proteins involved in cell wall regeneration in protoplasts of Arabidopsis suspension-cultured cells. DOI: 10.1093/pcp/pci089 ; PMID: 15769804
- Coordination of nuclear and mitochondrial genome expression during mitochondrial biogenesis in Arabidopsis. DOI: 10.1105/tpc.104.030254 ; PMID: 15829605
- Identification of Arabidopsis salt and osmotic stress responsive proteins using two-dimensional difference gel electrophoresis and mass spectrometry. DOI: 10.1002/pmic.200401282 ; PMID: 16254930
- Proteome mapping of mature pollen of Arabidopsis thaliana. DOI: 10.1002/pmic.200402011 ; PMID: 16247729
- Characterization of transformed Arabidopsis with altered alternative oxidase levels and analysis of effects on reactive oxygen species in tissue. DOI: 10.1104/pp.105.070763 ; PMID: 16299171
- WRKY70 modulates the selection of signaling pathways in plant defense. DOI: 10.1111/j.1365-313X.2006.02712.x ; PMID: 16623907
- Proteomic investigation of the effect of salicylic acid on Arabidopsis seed germination and establishment of early defense mechanisms. DOI: 10.1104/pp.106.082057 ; PMID: 16679420
- Modifications to the Arabidopsis defense proteome occur prior to significant transcriptional change in response to inoculation with Pseudomonas syringae. DOI: 10.1104/pp.106.086231 ; PMID: 17028151
- Functional characterization of a glycine-rich RNA-binding protein 2 in Arabidopsis thaliana under abiotic stress conditions. DOI: 10.1111/j.1365-313X.2007.03057.x ; PMID: 17376161
- Alternative and effective proteomic analysis in Arabidopsis. DOI: 10.1002/pmic.200700346 ; PMID: 17828791
- Proteome analysis of Arabidopsis leaf peroxisomes reveals novel targeting peptides, metabolic pathways, and defense mechanisms. DOI: 10.1105/tpc.107.050989 ; PMID: 17951448
- Cooperative ethylene and jasmonic acid signaling regulates selenite resistance in Arabidopsis. DOI: 10.1104/pp.107.110742 ; PMID: 18178671
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- Characterization of Arabidopsis lines deficient in GAPC-1, a cytosolic NAD-dependent glyceraldehyde-3-phosphate dehydrogenase. DOI: 10.1104/pp.108.128769 ; PMID: 18820081
- Identification of zinc-responsive proteins in the roots of Arabidopsis thaliana using a highly improved method of two-dimensional electrophoresis. DOI: 10.1093/pcp/pcp154 ; PMID: 19880396
- Divalent metal ions in plant mitochondria and their role in interactions with proteins and oxidative stress-induced damage to respiratory function. DOI: 10.1104/pp.109.147942 ; PMID: 20018591
- Seed-specific overexpression of antioxidant genes in Arabidopsis enhances oxidative stress tolerance during germination and early seedling growth. DOI: 10.1111/j.1467-7652.2010.00509.x ; PMID: 20691023
- Geomagnetic Field (Gmf) and Plant Evolution: Investigating the Effects of Gmf Reversal on Arabidopsis thaliana Development and Gene Expression. DOI: 10.3791/53286 ; PMID: 26649488
- SELENOPROTEIN O is a chloroplast protein involved in ROS scavenging and its absence increases dehydration tolerance in Arabidopsis thaliana. DOI: 10.1016/j.plantsci.2018.02.023 ; PMID: 29576081
- Arabidopsis Ca(2+)-dependent nuclease AtCaN2 plays a negative role in plant responses to salt stress. DOI: 10.1016/j.plantsci.2018.12.007 ; PMID: 30824054
- 24-Epibrassinolide promotes arsenic tolerance in Arabidopsis thaliana L. by altering stress responses at biochemical and molecular level. DOI: 10.1016/j.jplph.2019.05.002 ; PMID: 31121523
- Arabidopsis mtHSC70-1 plays important roles in the establishment of COX-dependent respiration and redox homeostasis. DOI: 10.1093/jxb/erz357 ; PMID: 31384929
- Mitochondrial HSC70-1 Regulates Polar Auxin Transport through ROS Homeostasis in Arabidopsis Roots. DOI: 10.3390/antiox11102035 ; PMID: 36290758
- The molecular chaperone mtHSC70-1 interacts with DjA30 to regulate female gametophyte development and fertility in Arabidopsis. DOI: 10.1111/tpj.16347 ; PMID: 37294615
- Superoxide dismutase in Arabidopsis: an eclectic enzyme family with disparate regulation and protein localization. DOI: 10.1104/pp.118.2.637 ; PMID: 9765550
- Analysis of the Arabidopsis mitochondrial proteome. DOI: 6919 ; PMID: 11743115
- Proteomic identification of divalent metal cation binding proteins in plant mitochondria. DOI: 10.1016/s0014-5793(03)00101-7 ; PMID: 12606038
- Experimental analysis of the Arabidopsis mitochondrial proteome highlights signaling and regulatory components, provides assessment of targeting prediction programs, and indicates plant-specific mitochondrial proteins. DOI: 10.1105/tpc.016055 ; PMID: 14671022
- Proteome mapping of mature pollen of Arabidopsis thaliana. DOI: 10.1002/pmic.200402011 ; PMID: 16247729
- Modifications to the Arabidopsis defense proteome occur prior to significant transcriptional change in response to inoculation with Pseudomonas syringae. DOI: 10.1104/pp.106.086231 ; PMID: 17028151
- Functional characterization of a glycine-rich RNA-binding protein 2 in Arabidopsis thaliana under abiotic stress conditions. DOI: 10.1111/j.1365-313X.2007.03057.x ; PMID: 17376161
- Comparative proteomic analysis of NaCl stress-responsive proteins in Arabidopsis roots. DOI: 10.1093/jxb/erm207 ; PMID: 17916636
- Analysis of protein complexes in Arabidopsis leaves using size exclusion chromatography and label-free protein correlation profiling. DOI: 10.1016/j.jprot.2017.06.004 ; PMID: 28627464
- Superoxide dismutase in Arabidopsis: an eclectic enzyme family with disparate regulation and protein localization. DOI: 10.1104/pp.118.2.637 ; PMID: 9765550
- Proteomic identification of divalent metal cation binding proteins in plant mitochondria. DOI: 10.1016/s0014-5793(03)00101-7 ; PMID: 12606038
- Proteome mapping of mature pollen of Arabidopsis thaliana. DOI: 10.1002/pmic.200402011 ; PMID: 16247729
- Modifications to the Arabidopsis defense proteome occur prior to significant transcriptional change in response to inoculation with Pseudomonas syringae. DOI: 10.1104/pp.106.086231 ; PMID: 17028151
- Comparative proteomic analysis of NaCl stress-responsive proteins in Arabidopsis roots. DOI: 10.1093/jxb/erm207 ; PMID: 17916636
Sequence:
cDNA Sequence
- >AT3G10920.2 ACTTATACACATGTTCATTTTTGGCGACCACTAGAAGGAGAAACAAATCTTCATTCCAACAATGGCGATTCGTTGTGTAGCGAGTAGAAAAACCCTAGCCGGCTTGAAGGAGACATCATCGAGGCTATTGAGGATCAGAGGGATTCAGACTTTTACGCTTCCTGATCTTCCTTACGATTATGGCGCATTGGAACCGGCCATTAGTGGAGAGATCATGCAGATTCATCACCAGAAGCATCACCAGGCTTATGTTACTAATTACAATAATGCTCTTGAGCAGCTTGATCAAGCTGTGAACAAGGGAGATGCTTCCACTGTTGTTAAGTTGCAGAGCGCCATCAAATTCAACGGCGGAGGTCATGTCAACCATTCGATTTTCTGGAAGAACCTTGCTCCTTCCAGTGAAGGTGGTGGAGAGCCACCAAAAGGATCTCTTGGTAGTGCCATTGACGCTCACTTTGGCTCCCTTGAAGGTCTGGTGAAAAAGATGAGTGCTGAGGGTGCTGCAGTGCAAGGCTCAGGATGGTGGCTCGGACTAGACAAAGAACTGAAGAAGCTAGTTGTTGACACAACTGCCAATCAGGATCCATTAGTGACAAAAGGAGGAAGCTTGGTACCTCTGGTGGGTATAGATGTTTGGGAGCACGCCTACTACTTGCAGTACAAAAATGTGAGGCCTGAGTATCTGAAGAATGTATGGAAAGTGATCAACTGGAAATATGCAAGCGAGGTTTATGAGAAGGAAAACAACTGAATCGTTTACACGATGACATAAGGAGATGAACCAGTTCCAGCTCAGCTTTTGTTTTAAGGTTGTCTGAAACAAACTTACAGTGTCTCTTTGGTTTTTAAGATTTGCTCAACTCAGCTGTGTGGTACGTTGTTTTACAATGAAAGTTTTCAAGAATAAAAATTTGCTATTATTGTCAGAAAGCGCTATTGTTTATTCTACGAAGAAAACAAAACGGAATCTTATTGGTATAATAATTACCTCATTTCAATAAAACAATAACTAATTTTCTCGTT
- >AT3G10920.1 ACTTATACACATGTTCATTTTTGGCGACCACTAGAAGGAGAAACAAATCTTCATTCCAACAATGGCGATTCGTTGTGTAGCGAGTAGAAAAACCCTAGCCGGCTTGAAGGAGACATCATCGAGGCTATTGAGGATCAGAGGGATTCAGACTTTTACGCTTCCTGATCTTCCTTACGATTATGGCGCATTGGAACCGGCCATTAGTGGAGAGATCATGCAGATTCATCACCAGAAGCATCACCAGGCTTATGTTACTAATTACAATAATGCTCTTGAGCAGCTTGATCAAGCTGTGAACAAGGGAGATGCTTCCACTGTTGTTAAGTTGCAGAGCGCCATCAAATTCAACGGCGGAGGTCATGTCAACCATTCGATTTTCTGGAAGAACCTTGCTCCTTCCAGTGAAGGTGGTGGAGAGCCACCAAAAGGATCTCTTGGTAGTGCCATTGACGCTCACTTTGGCTCCCTTGAAGGTCTGGTGAAAAAGATGAGTGCTGAGGGTGCTGCAGTGCAAGGCTCAGGATGGTGGCTCGGACTAGACAAAGAACTGAAGAAGCTAGTTGTTGACACAACTGCCAATCAGGATCCATTAGTGACAAAAGGAGGAAGCTTGGTACCTCTGGTGGGTATAGATGTTTGGGAGCACGCCTACTACTTGCAGTACAAAAATGTGAGGCCTGAGTATCTGAAGAATGTATGGAAAGTGATCAACTGGAAATATGCAAGCGAGGTTTATGAGAAGGAAAACAACTGAATCGTTTACACGATGACATAAGGAGATGAACCAGTTCCAGCTCAGCTTTTGTTTTAAGGTTGTCTGAAACAAACTTACAGTGTCTCTTTGGTTTTTAAGATTTGCTCAACTCAGCTGTGTGGTACGTTGTTTTACAATGAAAGTTTTCAAGAATAAAAATTTGCTATTATTGTCAGAAAGCGCTATTGTTTATTCTACGAAGAAAACAAAACGGAATCTTATTGGTATAATAATTACCTCATTTCAATAAAACAATAACTAATTTTCTCGTT
CDS Sequence
- >AT3G10920.2 ATGGCGATTCGTTGTGTAGCGAGTAGAAAAACCCTAGCCGGCTTGAAGGAGACATCATCGAGGCTATTGAGGATCAGAGGGATTCAGACTTTTACGCTTCCTGATCTTCCTTACGATTATGGCGCATTGGAACCGGCCATTAGTGGAGAGATCATGCAGATTCATCACCAGAAGCATCACCAGGCTTATGTTACTAATTACAATAATGCTCTTGAGCAGCTTGATCAAGCTGTGAACAAGGGAGATGCTTCCACTGTTGTTAAGTTGCAGAGCGCCATCAAATTCAACGGCGGAGGTCATGTCAACCATTCGATTTTCTGGAAGAACCTTGCTCCTTCCAGTGAAGGTGGTGGAGAGCCACCAAAAGGATCTCTTGGTAGTGCCATTGACGCTCACTTTGGCTCCCTTGAAGGTCTGGTGAAAAAGATGAGTGCTGAGGGTGCTGCAGTGCAAGGCTCAGGATGGTGGCTCGGACTAGACAAAGAACTGAAGAAGCTAGTTGTTGACACAACTGCCAATCAGGATCCATTAGTGACAAAAGGAGGAAGCTTGGTACCTCTGGTGGGTATAGATGTTTGGGAGCACGCCTACTACTTGCAGTACAAAAATGTGAGGCCTGAGTATCTGAAGAATGTATGGAAAGTGATCAACTGGAAATATGCAAGCGAGGTTTATGAGAAGGAAAACAACTGA
- >AT3G10920.1 ATGGCGATTCGTTGTGTAGCGAGTAGAAAAACCCTAGCCGGCTTGAAGGAGACATCATCGAGGCTATTGAGGATCAGAGGGATTCAGACTTTTACGCTTCCTGATCTTCCTTACGATTATGGCGCATTGGAACCGGCCATTAGTGGAGAGATCATGCAGATTCATCACCAGAAGCATCACCAGGCTTATGTTACTAATTACAATAATGCTCTTGAGCAGCTTGATCAAGCTGTGAACAAGGGAGATGCTTCCACTGTTGTTAAGTTGCAGAGCGCCATCAAATTCAACGGCGGAGGTCATGTCAACCATTCGATTTTCTGGAAGAACCTTGCTCCTTCCAGTGAAGGTGGTGGAGAGCCACCAAAAGGATCTCTTGGTAGTGCCATTGACGCTCACTTTGGCTCCCTTGAAGGTCTGGTGAAAAAGATGAGTGCTGAGGGTGCTGCAGTGCAAGGCTCAGGATGGTGGCTCGGACTAGACAAAGAACTGAAGAAGCTAGTTGTTGACACAACTGCCAATCAGGATCCATTAGTGACAAAAGGAGGAAGCTTGGTACCTCTGGTGGGTATAGATGTTTGGGAGCACGCCTACTACTTGCAGTACAAAAATGTGAGGCCTGAGTATCTGAAGAATGTATGGAAAGTGATCAACTGGAAATATGCAAGCGAGGTTTATGAGAAGGAAAACAACTGA
Protein Sequence
- >AT3G10920.2 MAIRCVASRKTLAGLKETSSRLLRIRGIQTFTLPDLPYDYGALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDQAVNKGDASTVVKLQSAIKFNGGGHVNHSIFWKNLAPSSEGGGEPPKGSLGSAIDAHFGSLEGLVKKMSAEGAAVQGSGWWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEKENN
- >AT3G10920.1 MAIRCVASRKTLAGLKETSSRLLRIRGIQTFTLPDLPYDYGALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDQAVNKGDASTVVKLQSAIKFNGGGHVNHSIFWKNLAPSSEGGGEPPKGSLGSAIDAHFGSLEGLVKKMSAEGAAVQGSGWWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEKENN