Gene Details:
- Gene ID: AT3G15580
- Gene Symbol: APG8H, ATG8I
- Gene Name: AUTOPHAGY 8H, AUTOPHAGY 8I
- Description: Ubiquitin-like superfamily protein;(source:Araport11)
- TAIR Accession: locus:2092560
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0000084 — plant sperm cell — célula espermática o esperma (Spanish, exact), male gamete (exact), microgamete (exact), 植物精子細胞 (Japanese, exact), sperm nucleus (related), sperm cell (broad)
- PO:0025195 — pollen tube cell — célula del tubo polínico (Spanish, exact), 花粉管細胞 (Japanese, exact)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
Gene Ontology:
- GO:0019776 — enables — Atg8-family ligase activity
- GO:0005776 — located in — autophagosome
- GO:0006995 — involved in — cellular response to nitrogen starvation
- GO:0010035 — acts upstream of or within — response to inorganic substance
- GO:0005775 — located in — vacuolar lumen
- GO:0006914 — acts upstream of or within — autophagy
- GO:0005737 — located in — cytoplasm
- GO:0019779 — enables — Atg8 activating enzyme activity
- GO:0030163 — acts upstream of or within — protein catabolic process
- GO:0019786 — enables — protein-phosphatidylethanolamide deconjugating activity
- GO:0005515 — enables — protein binding
Function-related keywords:
Literature:
- The APG8/12-activating enzyme APG7 is required for proper nutrient recycling and senescence in Arabidopsis thaliana. DOI: 10.1074/jbc.M204630200 ; PMID: 12070171
- Leaf senescence and starvation-induced chlorosis are accelerated by the disruption of an Arabidopsis autophagy gene. DOI: 10.1104/pp.011024 ; PMID: 12114572
- Large-scale identification of leaf senescence-associated genes. DOI: 10.1046/j.1365-313x.2003.01908.x ; PMID: 14617064
- Processing of ATG8s, ubiquitin-like proteins, and their deconjugation by ATG4s are essential for plant autophagy. DOI: 10.1105/tpc.104.025395 ; PMID: 15494556
- Visualization of autophagy in Arabidopsis using the fluorescent dye monodansylcadaverine and a GFP-AtATG8e fusion protein. DOI: 10.1111/j.1365-313X.2005.02396.x ; PMID: 15860017
- Autophagic nutrient recycling in Arabidopsis directed by the ATG8 and ATG12 conjugation pathways. DOI: 10.1104/pp.105.060673 ; PMID: 16040659
- Low-level radiocaesium exposure alters gene expression in roots of Arabidopsis. DOI: 10.1111/j.1469-8137.2005.01485.x ; PMID: 16159328
- Biosynthesis of cellulose-enriched tension wood in Populus: global analysis of transcripts and metabolites identifies biochemical and developmental regulators in secondary wall biosynthesis. DOI: 10.1111/j.1365-313X.2005.02584.x ; PMID: 16367961
- Starvation-induced expression of autophagy-related genes in Arabidopsis. DOI: 10.1042/BC20040516 ; PMID: 16354162
- Genome-wide analysis of Arabidopsis responsive transcriptome to nitrogen limitation and its regulation by the ubiquitin ligase gene NLA. DOI: 10.1007/s11103-007-9241-0 ; PMID: 17885809
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. DOI: 10.1104/pp.108.126375 ; PMID: 18775970
- An autophagy-associated Atg8 protein is involved in the responses of Arabidopsis seedlings to hormonal controls and abiotic stresses. DOI: 10.1093/jxb/ern244 ; PMID: 18836138
- The deubiquitinating enzyme AMSH1 and the ESCRT-III subunit VPS2.1 are required for autophagic degradation in Arabidopsis. DOI: 10.1105/tpc.113.113399 ; PMID: 23800962
- ATG8-Binding UIM Proteins Define a New Class of Autophagy Adaptors and Receptors. DOI: 10.1016/j.cell.2019.02.009 ; PMID: 30955882
- Phytopathogen Effectors Use Multiple Mechanisms to Manipulate Plant Autophagy. DOI: 10.1016/j.chom.2020.07.010 ; PMID: 32810441
- The phosphatidylinositol 3-phosphate effector FYVE3 regulates FYVE2-dependent autophagy in Arabidopsis thaliana. DOI: 10.3389/fpls.2023.1160162 ; PMID: 37008475
- An emerging role of non-canonical conjugation of ATG8 proteins in plant response to heat stress. DOI: 10.1080/15548627.2023.2219161 ; PMID: 37246814
Sequence:
cDNA Sequence
- >AT3G15580.1 ATTTTCTCAATTATTCCTTTTGACTTCGCCGCTTGCTTTTGAGAGACGGAGACAAAAACACACACGACGAAGAAATCTCCGGGCGGTCGAAGAAGATGAAATCGTTCAAGGAACAATACACGTTGGATGAAAGGCTCGCGGAGTCGCGGGAGATAATCGCTAAGTACCCTACTCGGATTCCAGTAATTGCTGAGAAGTATTGCAAAACGGATCTGCCTGCCATCGAGAAAAAGAAGTTTCTGGTTCCAAGAGATATGTCAGTTGGCCAATTCATCTACATATTGAGTGCTAGGTTACATTTGTCTCCTGGTAAAGCCTTATTCGTGTTTGTCAACAACACTCTCCCTCAAACTGCTGCTCTGATGGACTCGGTCTACGAATCTTACAAAGATGATGATGGATTCGTTTACATGTGCTATAGCAGTGAGAAAACCTTTGGTTGATCCAATAATGATGTTAGTGTCTGTGTACATATACTTTAAACATAAGATGTTCACTACATCAAAAGACATCAAACACTTGTTAAGCTTTATATGACTGCTGCTTGTTTTATCCTTAGACTTTGTTCATCTGTGCACAATCGTTCTACTACAGTCTCAGTTCCAACTAGTATTTCCCCTTAACGCTCTCTTTGTCATCATTGTTTATCTTCCTGAAAATGCAAAAGACCAATGGATTGTTTTACTAGGGGAAGAGTTTTGTGCTTCCTCTCCAGCAAGCACCACGAAGTGGCCACCAACCGGCAAATAGTTCTGGCTACTTTTGGTATCTTTATTAGATTCTGGTTCAGGCTCTGGGCTACAAACATAAGAAATAAGACTTGACATTGTAAAGGTAAAACACTAAACAAAAACTTGGAAGAATATAGAGGAAACAGTGTGGAAGAGTATACACATGTATTGTCTGTCTGATATCTGGATAATCTTTCCAAGTATAGAGTTAACATATTCGCAATTTCTGATGGTAAATGCCTAGTGTTTATATATTTGTAT
CDS Sequence
- >AT3G15580.1 ATGAAATCGTTCAAGGAACAATACACGTTGGATGAAAGGCTCGCGGAGTCGCGGGAGATAATCGCTAAGTACCCTACTCGGATTCCAGTAATTGCTGAGAAGTATTGCAAAACGGATCTGCCTGCCATCGAGAAAAAGAAGTTTCTGGTTCCAAGAGATATGTCAGTTGGCCAATTCATCTACATATTGAGTGCTAGGTTACATTTGTCTCCTGGTAAAGCCTTATTCGTGTTTGTCAACAACACTCTCCCTCAAACTGCTGCTCTGATGGACTCGGTCTACGAATCTTACAAAGATGATGATGGATTCGTTTACATGTGCTATAGCAGTGAGAAAACCTTTGGTTGA
Protein Sequence
- >AT3G15580.1 MKSFKEQYTLDERLAESREIIAKYPTRIPVIAEKYCKTDLPAIEKKKFLVPRDMSVGQFIYILSARLHLSPGKALFVFVNNTLPQTAALMDSVYESYKDDDGFVYMCYSSEKTFG