Gene Details:

  • Gene ID: AT3G16360
  • Gene Symbol: AHP4
  • Gene Name: HPT phosphotransmitter 4
  • Description: HPT phosphotransmitter 4;(source:Araport11)
  • TAIR Accession:
  • Genome: Araport11_genome_release
  • Species: Arabidopsis thaliana

Transcripts:

Germplasm Phenotype:

  • CS860146  — Inhibition of root elongation is similar to the wild type plants in the presence of various levels of exogenous cytokinin; root elongation in seedlings is inhibited by increasing concentrations of the cytokinin benzyl adenine (BA) in the growth media, showing a sharp decrease in root elongation between 10 and 50 nM BA.
  • CS860152  — Inhibition of root elongation is similar to the wild type plants in the presence of various levels of exogenous cytokinin; root elongation in seedlings is inhibited by increasing concentrations of the cytokinin benzyl adenine (BA) in the growth media, showing a sharp decrease in root elongation between 10 and 50 nM BA.
  • CS860154  — Inhibition of root elongation is similar to the wild type plants in the presence of various levels of exogenous cytokinin; root elongation in seedlings is inhibited by increasing concentrations of the cytokinin benzyl adenine (BA) in the growth media, showing a sharp decrease in root elongation between 10 and 50 nM BA.
  • CS860156  — Inhibition of root elongation is similar to the wild type plants in the presence of various levels of exogenous cytokinin; root elongation in seedlings is inhibited by increasing concentrations of the cytokinin benzyl adenine (BA) in the growth media, showing a sharp decrease in root elongation between 10 and 50 nM BA.
  • CS860158  — Inhibition of root elongation is similar to the wild type plants in the presence of various levels of exogenous cytokinin; root elongation in seedlings is inhibited by increasing concentrations of the cytokinin benzyl adenine (BA) in the growth media, showing a sharp decrease in root elongation between 10 and 50 nM BA.
  • CS860162  — Reduced inhibition of hypocotyl elongation in response to cytokinin, consistent with reduced sensitivity to the hormone; very short and narrow primary root; xylem development in the narrow primary root is less extensive than in the larger primary root of wild-type plants.
  • CS860163  — Inhibition of root elongation is substantially less sensitive to cytokinin than the wild type plants and is less responsive to cytokinin over the whole range of cytokinin benzyl adenine (BA) concentrations used in the growth media; roots are longer than those of wild-type plants when grown on near-saturating levels of cytokinin (10 uM BA). It is not significantly different from the response of the ahp1,2,3 triple mutant, which indicates that AHP4 does not play a substantial role in this response; reduced inhibition of hypocotyl elongation in response to cytokinin, consistent with reduced sensitivity to the hormone.
  • CS860164  — Abnormal growth and development: reduced vascular development in primary root; very short and narrow primary root; adventitious root development; smaller rosettes, shorter siliques, fewer seeds per silique; larger seeds and larger embryos than the wild type; reduced fertility; increased hypocotyl elongation in the presence of cytokinin.

Literature:

Sequence:

cDNA Sequence
  • >AT3G16360.2 CGATCTATTTATTTATTCTATATTTCACTATATATATCTCAGATGTCCAACGTTTCAGTATTGCATTGCCACTCGAATTACCTAAGATAAAAACGAATTATCACTTTGATTTTTCGCACTTATAGTTAAATCTATTCTCAAAATTTAAACAAACATGCAGAGGCAAGTGGCACTCATCAAGCAGTCCCTCTTTGATCAGGGATATCTCGACGAACAATTCATGGAGTTAGAAGAGCTCCAAGATGATGCAAACCCTAATTTTGTTGAAGAAGTTTCCGCATTATACTTCAAAGATTCAGCTCGGTTAATCAATAACATTGACCAAGCTTTGGAAAGAGGATCATTTGATTTCAATCGGCTGGATAGTTACATGCATCAGTTTAAGGGAAGCAGCACGAGCATTGGGGCAAGTAAAGTGAAAGCTGAATGCACTACGTTTAGGGAATACTGCAGAGCTGGAAATGCGGAAGGATGCTTGAGGACTTTCCAGCAACTGAAGAAAGAACACTCAACGTTGAGAAAGAAGCTTGAACATTATTTCCAGTTGGCAAGGCAGGCGGGGCCTAAGGAGACAGCACGTAGGCCCAAGTAAGAGAGAAAGAGAGAGAGACAGAGATAAATGAGGAATCGTCGTCGAATTTTGTAGCAAAACTATATAATAAATAGTTCCTCTTTATTTTTATATATTTCGATGTACGTTATAAAGAAGGTTTTGGACTTTTATATTATGTCCGTTAATAAACGGTCCAAATGTCTCTATGTTTTTCCCCTTATATCGCCAAATTTTCCCTTGGGAGTTTTATAGCTACGATTACCTCGTAACATATGGCTTCCTCTAATAACGGAATACAGAAAAGAGTGGA
  • >AT3G16360.1 CGATCTATTTATTTATTCTATATTTCACTATATATATCTCAGATGTCCAACGTTTCAGTATTGCATTGCCACTCGAATTACCTAAGATAAAAACGAATTATCACTTTGATTTTTCGCACTTATAGTTAAATCTATTCTCAAAATTTAAACAAACATGCAGAGGCAAGTGGCACTCATCAAGCAGTCCCTCTTTGATCAGGGATATCTCGACGAACAATTCATGGAGTTAGAAGAGCTCCAAGATGATGCAAACCCTAATTTTGTTGAAGAAGTTTCCGCATTATACTTCAAAGATTCAGCTCGGTTAATCAATAACATTGACCAAGCTTTGGAAAGAGGATCATTTGATTTCAATCGGCTGGATAGTTACATGCATCAGTTTAAGGGAAGCAGCACGAGCATTGGGGCAAGTAAAGTGAAAGCTGAATGCACTACGTTTAGGGAATACTGCAGAGCTGGAAATGCGGAAGGATGCTTGAGGACTTTCCAGCAACTGAAGAAAGAACACTCAACGTTGAGAAAGAAGCTTGAACATTATTTCCAGTTGGCAAGGCAGGCGGGGCCTAAGGAGACAGCACGTAGGCCCAAGTAAGAGAGAAAGAGAGAGAGACAGAGATAAATGAGGAATCGTCGTCGAATTTTGTAGCAAAACTATATAATAAATAGTTCCTCTTTATTTTTATATATTTCGATGTACGTTATAAAGAAGGTTTTGGACTTTTATATTATGTCCGTTAATAAACGGTCCAAATGTCTCTATGTTTTTCCCCTTATATCGCCAAATTTTCCCTTGGGAGTTTTATAGCTACGATTACCTCGTAACATATGGCTTCCTCTAATAACGGAATACAGAAAAGAGTGGA
CDS Sequence
  • >AT3G16360.2 ATGCAGAGGCAAGTGGCACTCATCAAGCAGTCCCTCTTTGATCAGGGATATCTCGACGAACAATTCATGGAGTTAGAAGAGCTCCAAGATGATGCAAACCCTAATTTTGTTGAAGAAGTTTCCGCATTATACTTCAAAGATTCAGCTCGGTTAATCAATAACATTGACCAAGCTTTGGAAAGAGGATCATTTGATTTCAATCGGCTGGATAGTTACATGCATCAGTTTAAGGGAAGCAGCACGAGCATTGGGGCAAGTAAAGTGAAAGCTGAATGCACTACGTTTAGGGAATACTGCAGAGCTGGAAATGCGGAAGGATGCTTGAGGACTTTCCAGCAACTGAAGAAAGAACACTCAACGTTGAGAAAGAAGCTTGAACATTATTTCCAGTTGGCAAGGCAGGCGGGGCCTAAGGAGACAGCACGTAGGCCCAAGTAA
  • >AT3G16360.1 ATGCAGAGGCAAGTGGCACTCATCAAGCAGTCCCTCTTTGATCAGGGATATCTCGACGAACAATTCATGGAGTTAGAAGAGCTCCAAGATGATGCAAACCCTAATTTTGTTGAAGAAGTTTCCGCATTATACTTCAAAGATTCAGCTCGGTTAATCAATAACATTGACCAAGCTTTGGAAAGAGGATCATTTGATTTCAATCGGCTGGATAGTTACATGCATCAGTTTAAGGGAAGCAGCACGAGCATTGGGGCAAGTAAAGTGAAAGCTGAATGCACTACGTTTAGGGAATACTGCAGAGCTGGAAATGCGGAAGGATGCTTGAGGACTTTCCAGCAACTGAAGAAAGAACACTCAACGTTGAGAAAGAAGCTTGAACATTATTTCCAGTTGGCAAGGCAGGCGGGGCCTAAGGAGACAGCACGTAGGCCCAAGTAA
Protein Sequence
  • >AT3G16360.2 MQRQVALIKQSLFDQGYLDEQFMELEELQDDANPNFVEEVSALYFKDSARLINNIDQALERGSFDFNRLDSYMHQFKGSSTSIGASKVKAECTTFREYCRAGNAEGCLRTFQQLKKEHSTLRKKLEHYFQLARQAGPKETARRPK
  • >AT3G16360.1 MQRQVALIKQSLFDQGYLDEQFMELEELQDDANPNFVEEVSALYFKDSARLINNIDQALERGSFDFNRLDSYMHQFKGSSTSIGASKVKAECTTFREYCRAGNAEGCLRTFQQLKKEHSTLRKKLEHYFQLARQAGPKETARRPK