Gene Details:
- Gene ID: AT3G20865
- Gene Symbol: AGP40
- Gene Name: arabinogalactan protein 40
- Description: arabinogalactan protein 40;(source:Araport11)
- TAIR Accession:
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0025195 — pollen tube cell — célula del tubo polínico (Spanish, exact), 花粉管細胞 (Japanese, exact)
Function-related keywords:
Literature:
- Prediction of glycosylphosphatidylinositol-anchored proteins in Arabidopsis. A genomic analysis. DOI: 10.1104/pp.010884 ; PMID: 12068095
- Identification of glycosylphosphatidylinositol-anchored proteins in Arabidopsis. A proteomic and genomic analysis. DOI: 10.1104/pp.103.021170 ; PMID: 12805588
- SETH1 and SETH2, two components of the glycosylphosphatidylinositol anchor biosynthetic pathway, are required for pollen germination and tube growth in Arabidopsis. DOI: 10.1105/tpc.014407 ; PMID: 14671020
- Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. DOI: 10.1104/pp.108.126375 ; PMID: 18775970
- Arabidopsis AT-hook protein TEK positively regulates the expression of arabinogalactan proteins in controlling nexine layer formation in the pollen wall. DOI: 10.1093/mp/ssu114 ; PMID: 25336567
- Arabidopsis AT-hook protein TEK positively regulates the expression of arabinogalactan proteins for Nexine formation. DOI: 10.1016/j.molp.2014.10.001 ; PMID: 25616387
- Phenotypic screening of Arabidopsis T-DNA insertion lines for cell wall mechanical properties revealed ANTHOCYANINLESS2, a cell wall-related gene. DOI: 10.1016/j.jplph.2015.11.011 ; PMID: 26720211
- Identification of glycosylphosphatidylinositol-anchored proteins in Arabidopsis. A proteomic and genomic analysis. DOI: 10.1104/pp.103.021170 ; PMID: 12805588
- SETH1 and SETH2, two components of the glycosylphosphatidylinositol anchor biosynthetic pathway, are required for pollen germination and tube growth in Arabidopsis. DOI: 10.1105/tpc.014407 ; PMID: 14671020
Sequence:
cDNA Sequence
- >AT3G20865.1 ATCACAACCAAAAATACAAAACAACAACCAAAAAACAAAAAACCAAAAAAAAAAACAAAAAAAAAACAAGAAATAATGGAGATGAAGAACATCTTTGTGGCCCTCTTTATCTCGGCCGTGTTAGTGAGCTCAGTCTCCGCGGCTACAATGGAGTCTCCAGCACCATCACCAGGTGCTTCCTCTGCCTCCACCGTAGCTTTTCCGGTGGTTGGCTCCATTGTTGCTGCATCACTCTCCGCCTTCTTGGCTCTTCTCTTGCAGTAGAAAGACAAGAGTCCTCAAAATATGAGAAGGAGATATATAACAAAACTCTTTTTTTGTTCTGATTTTGTTCCTTAGAATCTATGATGACAAATAACCCATTTTGATGTATAATCTCATTGTGTAAGTTATTACACTAATATATATGAGTATATGATAATAATAACACTATTTTATCAGATCTAATGATATCTGATC
CDS Sequence
- >AT3G20865.1 ATGGAGATGAAGAACATCTTTGTGGCCCTCTTTATCTCGGCCGTGTTAGTGAGCTCAGTCTCCGCGGCTACAATGGAGTCTCCAGCACCATCACCAGGTGCTTCCTCTGCCTCCACCGTAGCTTTTCCGGTGGTTGGCTCCATTGTTGCTGCATCACTCTCCGCCTTCTTGGCTCTTCTCTTGCAGTAG
Protein Sequence
- >AT3G20865.1 MEMKNIFVALFISAVLVSSVSAATMESPAPSPGASSASTVAFPVVGSIVAASLSAFLALLLQ