Gene Details:
- Gene ID: AT3G23240
- Gene Symbol: AtERF, ERF1, ERF1B
- Gene Name: , ethylene response factor 1
- Description: ethylene response factor 1;(source:Araport11)
- TAIR Accession:
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009029 — stamen — estambre (Spanish, exact), 雄蕊 (Japanese, exact), Poaceae stamen (narrow), Zea stamen (narrow)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
Function-related keywords:
Literature:
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- Genome-wide analysis of the ERF gene family in Arabidopsis and rice. DOI: 10.1104/pp.105.073783 ; PMID: 16407444
- The AP2/ERF domain transcription factor ORA59 integrates jasmonic acid and ethylene signals in plant defense. DOI: 10.1104/pp.108.117523 ; PMID: 18467450
- Arabidopsis thaliana class-II TGA transcription factors are essential activators of jasmonic acid/ethylene-induced defense responses. DOI: 10.1111/j.1365-313X.2009.04044.x ; PMID: 19832945
- The development of protein microarrays and their applications in DNA-protein and protein-protein interaction analyses of Arabidopsis transcription factors. DOI: 10.1093/mp/ssm009 ; PMID: 19802365
- Synergistic activation of defense responses in Arabidopsis by simultaneous loss of the GSL5 callose synthase and the EDR1 protein kinase. DOI: 10.1094/MPMI-23-5-0578 ; PMID: 20367466
- Do ethylene response factorS9 and -14 repress PR gene expression in the interaction between Piriformospora indica and Arabidopsis? DOI: 10.4161/psb.5.8.12036 ; PMID: 20505369
- Regulation of Arabidopsis defense responses against Spodoptera littoralis by CPK-mediated calcium signaling. DOI: 10.1186/1471-2229-10-97 ; PMID: 20504319
- Proteome analysis of Arabidopsis seedlings exposed to bacterial volatiles. DOI: 10.1007/s00425-010-1259-x ; PMID: 20820802
- Improved protein-binding microarrays for the identification of DNA-binding specificities of transcription factors. DOI: 10.1111/j.1365-313X.2011.04519.x ; PMID: 21284757
- rather than α-tocopherol alters ethylene signaling gene expression in the vte4 mutant of Arabidopsis thaliana. DOI: 10.1093/pcp/pcr085 ; PMID: 21719428
- The role of histone methylation and H2A.Z occupancy during rapid activation of ethylene responsive genes. DOI: 10.1371/journal.pone.0028224 ; PMID: 22140554
- ERF5 and ERF6 play redundant roles as positive regulators of JA/Et-mediated defense against Botrytis cinerea in Arabidopsis. DOI: 10.1371/journal.pone.0035995 ; PMID: 22563431
- Characterization of a novel ERF transcription factor in Artemisia annua and its induction kinetics after hormones and stress treatments. DOI: 10.1007/s11033-012-1816-4 ; PMID: 22714923
- MEDIATOR25 acts as an integrative hub for the regulation of jasmonate-responsive gene expression in Arabidopsis. DOI: 10.1104/pp.112.202697 ; PMID: 22822211
- A molecular framework of light-controlled phytohormone action in Arabidopsis. DOI: 10.1016/j.cub.2012.06.039 ; PMID: 22818915
- and light-regulated hypocotyl elongation. DOI: 10.1007/s00425-012-1730-y ; PMID: 22890836
- Arabidopsis redox status in response to caterpillar herbivory. DOI: 10.3389/fpls.2013.00113 ; PMID: 23653629
- Arabidopsis BPM proteins function as substrate adaptors to a cullin3-based E3 ligase to affect fatty acid metabolism in plants. DOI: 10.1105/tpc.112.107292 ; PMID: 23792371
- GDSL LIPASE1 modulates plant immunity through feedback regulation of ethylene signaling. DOI: 10.1104/pp.113.225649 ; PMID: 24170202
- cGMP and ethylene are involved in maintaining ion homeostasis under salt stress in Arabidopsis roots. DOI: 10.1007/s00299-013-1545-8 ; PMID: 24306353
- Salicylic acid suppresses jasmonic acid signaling downstream of SCFCOI1-JAZ by targeting GCC promoter motifs via transcription factor ORA59. DOI: 10.1105/tpc.112.108548 ; PMID: 23435661
- Growth of Arabidopsis seedlings on high fungal doses of Piriformospora indica has little effect on plant performance, stress, and defense gene expression in spite of elevated jasmonic acid and jasmonic acid-isoleucine levels in the roots. DOI: 10.4161/psb.26301 ; PMID: 24047645
- GDSL lipase 1 regulates ethylene signaling and ethylene-associated systemic immunity in Arabidopsis. DOI: 10.1016/j.febslet.2014.02.062 ; PMID: 24631536
- Ethylene-orchestrated circuitry coordinates a seedling's response to soil cover and etiolated growth. DOI: 10.1073/pnas.1402491111 ; PMID: 24599595
- Cadmium-induced ethylene production and responses in Arabidopsis thaliana rely on ACS2 and ACS6 gene expression. DOI: 10.1186/s12870-014-0214-6 ; PMID: 25082369
- ERF022 impacts the induction of somatic embryogenesis in Arabidopsis through the ethylene-related pathway. DOI: 10.1007/s00425-014-2225-9 ; PMID: 25534944
- ETHYLENE RESPONSE FACTOR 96 positively regulates Arabidopsis resistance to and ethylene-responsive defence genes. DOI: 10.1111/pce.12583 ; PMID: 26038230
- Loss of Arabidopsis 5'-3' Exoribonuclease AtXRN4 Function Enhances Heat Stress Tolerance of Plants Subjected to Severe Heat Stress. DOI: 10.1093/pcp/pcv096 ; PMID: 26136597
- Paraburkholderia phytofirmans PsJN Protects Arabidopsis thaliana Against a Virulent Strain of Pseudomonas syringae Through the Activation of Induced Resistance. DOI: 10.1094/MPMI-09-16-0192-R ; PMID: 28118091
- Integration of Ethylene and Light Signaling Affects Hypocotyl Growth in Arabidopsis. DOI: 10.3389/fpls.2017.00057 ; PMID: 28174592
- Resistance of Fusarium poae in Arabidopsis leaves requires mainly functional JA and ET signaling pathways. DOI: 10.1016/j.funbio.2017.06.001 ; PMID: 28889908
- ERF72 interacts with ARF6 and BZR1 to regulate hypocotyl elongation in Arabidopsis. DOI: 10.1093/jxb/ery220 ; PMID: 29897568
- CHITINASE LIKE1 Regulates Root Development of Dark-Grown Seedlings by Modulating Ethylene Biosynthesis in Arabidopsis thaliana. DOI: 10.3389/fpls.2019.00600 ; PMID: 31156671
- Transcriptional regulation of nitrogen-associated metabolism and growth. DOI: 10.1038/s41586-018-0656-3 ; PMID: 30356219
- ABI3 mediated repression of RAV1 gene expression promotes efficient dehydration stress response in Arabidopsis thaliana. DOI: 10.1016/j.bbagrm.2020.194582 ; PMID: 32442719
- The PIFs Redundantly Control Plant Defense Response against Botrytis cinerea in Arabidopsis. DOI: 10.3390/plants9091246 ; PMID: 32967288
- FITNESS Acts as a Negative Regulator of Immunity and Influences the Plant Reproductive Output After Pseudomonas syringae Infection. DOI: 10.3389/fpls.2021.606791 ; PMID: 33613599
- ERF1 delays flowering through direct inhibition of FLOWERING LOCUS T expression in Arabidopsis. DOI: 10.1111/jipb.13144 ; PMID: 34152677
- 2-Hydroxymelatonin, Rather Than Melatonin, Is Responsible for RBOH-Dependent Reactive Oxygen Species Production Leading to Premature Senescence in Plants. DOI: 10.3390/antiox10111728 ; PMID: 34829600
- The Endophytic Strain ZS-3 Enhances Salt Tolerance in Arabidopsis thaliana by Regulating Photosynthesis, Osmotic Stress, and Ion Homeostasis and Inducing Systemic Tolerance. DOI: 10.3389/fpls.2022.820837 ; PMID: 35386673
- Multilayered synergistic regulation of phytoalexin biosynthesis by ethylene, jasmonate, and MAPK signaling pathways in Arabidopsis. DOI: 10.1093/plcell/koac139 ; PMID: 35543483
- Ethylene Acts as a Local and Systemic Signal to Mediate UV-B-Induced Nitrate Reallocation to Arabidopsis Leaves and Roots via Regulating the ERFs-NRT1.8 Signaling Module. DOI: 10.3390/ijms23169068 ; PMID: 36012333
- ERF1 inhibits lateral root emergence by promoting local auxin accumulation and repressing ARF7 expression. DOI: 10.1016/j.celrep.2023.112565 ; PMID: 37224012
- Arabidopsis ethylene-responsive element binding factors act as transcriptional activators or repressors of GCC box-mediated gene expression. DOI: 10.1105/tpc.12.3.393 ; PMID: 10715325
- Nuclear events in ethylene signaling: a transcriptional cascade mediated by ETHYLENE-INSENSITIVE3 and ETHYLENE-RESPONSE-FACTOR1. DOI: 10.1101/gad.12.23.3703 ; PMID: 9851977
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- ETHYLENE RESPONSE FACTOR1 integrates signals from ethylene and jasmonate pathways in plant defense. DOI: 10.1105/tpc.007468 ; PMID: 12509529
- Arabidopsis ethylene signaling pathway. DOI: 10.1126/stke.2762005cm4 ; PMID: 15784880
- Molecular players regulating the jasmonate signalling network. DOI: 10.1016/j.pbi.2005.07.003 ; PMID: 16039901
- Genome-wide analysis of the ERF gene family in Arabidopsis and rice. DOI: 10.1104/pp.105.073783 ; PMID: 16407444
- and jasmonic acid/ethylene-dependent responses via EDS1 and PAD4. DOI: 10.1111/j.1365-313X.2006.02806.x ; PMID: 16813576
- AtERF14, a member of the ERF family of transcription factors, plays a nonredundant role in plant defense. DOI: 10.1104/pp.106.086637 ; PMID: 17114278
- Silverleaf whitefly induces salicylic acid defenses and suppresses effectual jasmonic acid defenses. DOI: 10.1104/pp.106.090035 ; PMID: 17189328
- Arabidopsis enhanced ethylene response 4 encodes an EIN3-interacting TFIID transcription factor required for proper ethylene response, including ERF1 induction. DOI: 10.1093/jxb/erm080 ; PMID: 17526916
- Ethylene is one of the key elements for cell death and defense response control in the Arabidopsis lesion mimic mutant vad1. DOI: 10.1104/pp.107.106302 ; PMID: 17720753
Sequence:
cDNA Sequence
- >AT3G23240.1 TTTTTTCTCTATATATATAGACCATGTCAATCCACTAACGATCCCTAACCGAAAACAGAGTAGTCAAGAAACAGAGTATTTTTTCTACATGGATCCATTTTTAATTCAGTCCCCATTCTCCGGCTTCTCACCGGAATATTCTATCGGATCTTCTCCAGATTCTTTCTCATCCTCTTCTTCTAACAATTACTCTCTTCCCTTCAACGAGAACGACTCAGAGGAAATGTTTCTCTACGGTCTAATCGAGCAGTCCACGCAACAAACCTATATTGACTCGGATAGTCAAGACCTTCCGATCAAATCCGTAAGCTCAAGAAAGTCAGAGAAGTCTTACAGAGGCGTAAGACGACGGCCATGGGGGAAATTCGCGGCGGAGATAAGAGATTCGACTAGAAACGGTATTAGGGTTTGGCTCGGGACGTTCGAAAGCGCGGAAGAGGCGGCTTTAGCCTACGATCAAGCTGCTTTCTCGATGAGAGGGTCCTCGGCGATTCTCAATTTTTCGGCGGAGAGAGTTCAAGAGTCGCTTTCGGAGATTAAATATACCTACGAGGATGGTTGTTCTCCGGTTGTGGCGTTGAAGAGGAAACACTCGATGAGACGGAGAATGACCAATAAGAAGACGAAAGATAGTGACTTTGATCACCGCTCCGTGAAGTTAGATAATGTAGTTGTCTTTGAGGATTTGGGAGAACAGTACCTTGAGGAGCTTTTGGGGTCTTCTGAAAATAGTGGGACTTGGTGAAAGATTAGGATTTGTATTAGGGACCTTAAGTTTGAAGTGGTTGATTAATTTTAACCCTAATATGTTTTTTGTTTGCTTAAATATTTGATTCTATTGAGAAACATCGAAAACAGTTTGTATGTATTTTTGTGATACTTGACTTTATCAATTTCAAGTTAGTGTAAAAGTCTTTGTCTCTTACTATTCAACTAGTAAGAAAACTCTCATTTTTCTTATTTATCGTAATGAGGATTGTCTTTAAGC
CDS Sequence
- >AT3G23240.1 ATGGATCCATTTTTAATTCAGTCCCCATTCTCCGGCTTCTCACCGGAATATTCTATCGGATCTTCTCCAGATTCTTTCTCATCCTCTTCTTCTAACAATTACTCTCTTCCCTTCAACGAGAACGACTCAGAGGAAATGTTTCTCTACGGTCTAATCGAGCAGTCCACGCAACAAACCTATATTGACTCGGATAGTCAAGACCTTCCGATCAAATCCGTAAGCTCAAGAAAGTCAGAGAAGTCTTACAGAGGCGTAAGACGACGGCCATGGGGGAAATTCGCGGCGGAGATAAGAGATTCGACTAGAAACGGTATTAGGGTTTGGCTCGGGACGTTCGAAAGCGCGGAAGAGGCGGCTTTAGCCTACGATCAAGCTGCTTTCTCGATGAGAGGGTCCTCGGCGATTCTCAATTTTTCGGCGGAGAGAGTTCAAGAGTCGCTTTCGGAGATTAAATATACCTACGAGGATGGTTGTTCTCCGGTTGTGGCGTTGAAGAGGAAACACTCGATGAGACGGAGAATGACCAATAAGAAGACGAAAGATAGTGACTTTGATCACCGCTCCGTGAAGTTAGATAATGTAGTTGTCTTTGAGGATTTGGGAGAACAGTACCTTGAGGAGCTTTTGGGGTCTTCTGAAAATAGTGGGACTTGGTGA
Protein Sequence
- >AT3G23240.1 MDPFLIQSPFSGFSPEYSIGSSPDSFSSSSSNNYSLPFNENDSEEMFLYGLIEQSTQQTYIDSDSQDLPIKSVSSRKSEKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGSSAILNFSAERVQESLSEIKYTYEDGCSPVVALKRKHSMRRRMTNKKTKDSDFDHRSVKLDNVVVFEDLGEQYLEELLGSSENSGTW