Gene Details:
- Gene ID: AT3G25760
- Gene Symbol: AOC1, ERD12
- Gene Name: allene oxide cyclase 1, early-responsive to dehydration 12
- Description: allene oxide cyclase 1;(source:Araport11)
- TAIR Accession:
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0025195 — pollen tube cell — célula del tubo polínico (Spanish, exact), 花粉管細胞 (Japanese, exact)
Function-related keywords:
Literature:
- Cloning of cDNAs for genes that are early-responsive to dehydration stress (ERDs) in Arabidopsis thaliana L.: identification of three ERDs as HSP cognate genes. DOI: 10.1007/BF00028874 ; PMID: 8075396
- Evidence supporting a role of jasmonic acid in Arabidopsis leaf senescence. DOI: 10.1104/pp.010843 ; PMID: 11891244
- Jasmonate biosynthesis and the allene oxide cyclase family of Arabidopsis thaliana. DOI: 10.1023/a:1023049319723 ; PMID: 12777050
- Large-scale identification of leaf senescence-associated genes. DOI: 10.1046/j.1365-313x.2003.01908.x ; PMID: 14617064
- The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis. DOI: 10.1038/sj.emboj.7600337 ; PMID: 15282545
- New functions of the thylakoid membrane proteome of Arabidopsis thaliana revealed by a simple, fast, and versatile fractionation strategy. DOI: 10.1074/jbc.M406763200 ; PMID: 15322131
- The potassium-dependent transcriptome of Arabidopsis reveals a prominent role of jasmonic acid in nutrient signaling. DOI: 10.1104/pp.104.046482 ; PMID: 15347784
- The MAP kinase substrate MKS1 is a regulator of plant defense responses. DOI: 10.1038/sj.emboj.7600737 ; PMID: 15990873
- Genome-wide transcriptional analysis of the Arabidopsis thaliana interaction with the plant pathogen Pseudomonas syringae pv. tomato DC3000 and the human pathogen Escherichia coli O157:H7. DOI: 10.1111/j.1365-313X.2006.02725.x ; PMID: 16553894
- Different plant hormones regulate similar processes through largely nonoverlapping transcriptional responses. DOI: 10.1016/j.cell.2006.05.050 ; PMID: 16901781
- Comprehensive transcriptional profiling of NaCl-stressed Arabidopsis roots reveals novel classes of responsive genes. DOI: 10.1186/1471-2229-6-25 ; PMID: 17038189
- Arabidopsis transcriptome changes in response to phloem-feeding silverleaf whitefly nymphs. Similarities and distinctions in responses to aphids. DOI: 10.1104/pp.106.090662 ; PMID: 17189325
- AtPLAI is an acyl hydrolase involved in basal jasmonic acid production and Arabidopsis resistance to Botrytis cinerea. DOI: 10.1074/jbc.M700405200 ; PMID: 17475618
- Phytochrome chromophore deficiency leads to overproduction of jasmonic acid and elevated expression of jasmonate-responsive genes in Arabidopsis. DOI: 10.1093/pcp/pcm076 ; PMID: 17567636
- Analysis of gene expression profiles in response to Sclerotinia sclerotiorum in Brassica napus. DOI: 10.1007/s00425-007-0586-z ; PMID: 17665211
- Comparative transcriptome of diurnally oscillating genes and hormone-responsive genes in Arabidopsis thaliana: insight into circadian clock-controlled daily responses to common ambient stresses in plants. DOI: 10.1093/pcp/pcn008 ; PMID: 18202002
- Stamen abscission zone transcriptome profiling reveals new candidates for abscission control: enhanced retention of floral organs in transgenic plants overexpressing Arabidopsis ZINC FINGER PROTEIN2. DOI: 10.1104/pp.107.110908 ; PMID: 18192438
- Proteomic analysis of S-nitrosylated proteins in Arabidopsis thaliana undergoing hypersensitive response. DOI: 10.1002/pmic.200700536 ; PMID: 18297659
- An extensive (co-)expression analysis tool for the cytochrome P450 superfamily in Arabidopsis thaliana. DOI: 10.1186/1471-2229-8-47 ; PMID: 18433503
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- Transcriptional responses of Arabidopsis thaliana plants to As (V) stress. DOI: 10.1186/1471-2229-8-87 ; PMID: 18684332
- Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. DOI: 10.1104/pp.108.126375 ; PMID: 18775970
- and organ-specific promoter activities and in vivo heteromerization. DOI: 10.1093/jxb/ers261 ; PMID: 23028017
- Acyl-lipid metabolism. DOI: 10.1199/tab.0161 ; PMID: 23505340
- Endogenous Arabidopsis messenger RNAs transported to distant tissues. DOI: 10.1038/nplants.2015.25 ; PMID: 27247031
- Activity Regulation by Heteromerization of Arabidopsis Allene Oxide Cyclase Family Members. DOI: 10.3390/plants5010003 ; PMID: 27135223
- Arabidopsis Pollen Fertility Requires the Transcription Factors CITF1 and SPL7 That Regulate Copper Delivery to Anthers and Jasmonic Acid Synthesis. DOI: 10.1105/tpc.17.00363 ; PMID: 29114014
- Mitochondrial function modulates touch signalling in Arabidopsis thaliana. DOI: 10.1111/tpj.14183 ; PMID: 30537160
- Cyclophilin AtROC1(S58F) confers Arabidopsis cold tolerance by modulating jasmonic acid signaling and antioxidant metabolism. DOI: 10.1016/j.plaphy.2020.04.012 ; PMID: 32388423
- Molecular cloning of allene oxide cyclase. The enzyme establishing the stereochemistry of octadecanoids and jasmonates. DOI: 10.1074/jbc.M002133200 ; PMID: 10764787
- Proteomic study of the Arabidopsis thaliana chloroplastic envelope membrane utilizing alternatives to traditional two-dimensional electrophoresis. DOI: 10.1021/pr034025j ; PMID: 12938931
- The Arabidopsis thaliana chloroplast proteome reveals pathway abundance and novel protein functions. DOI: 10.1016/j.cub.2004.02.039 ; PMID: 15028209
- New functions of the thylakoid membrane proteome of Arabidopsis thaliana revealed by a simple, fast, and versatile fractionation strategy. DOI: 10.1074/jbc.M406763200 ; PMID: 15322131
- Proteomic analysis of S-nitrosylated proteins in Arabidopsis thaliana undergoing hypersensitive response. DOI: 10.1002/pmic.200700536 ; PMID: 18297659
- Sorting signals, N-terminal modifications and abundance of the chloroplast proteome. DOI: 10.1371/journal.pone.0001994 ; PMID: 18431481
- Analysis of protein complexes in Arabidopsis leaves using size exclusion chromatography and label-free protein correlation profiling. DOI: 10.1016/j.jprot.2017.06.004 ; PMID: 28627464
Sequence:
cDNA Sequence
- >AT3G25760.1 CGTTGGTGACCCATTTTTGGGATATTTAGCATTATCCCATTCACCATTTATCAGCCATCAATCATTCATCCAATATATATACACATAGACATTTCGTAAAACTCAAATCACTCACCACATAAAACCAAAGTCCCATCTCTTAAAAAACTAATCATTTCAAAGTTTTGTCTCTAGTCTTTCTTTTTATTGAGCAATGGCTTCTTCTACAATCTCTCTCCAATCTATCTCCATGACAACTCTCAACAATCTCTCATATAGTAAACAATTTCATCGAAGCTCTCTTCTTGGTTTCTCTAAATCCTTCCAAAATTTTGGTATCTCATCTAACGGTCCAGGTTCCTCCTCTCCGACAAGTTTCACGCCCAAGAAGAAACTCACTCCTACTCGAGCTCTCTCTCAGAACTTGGGAAATACCGAAAACCCCAGACCAAGCAAAGTTCAAGAACTGAGCGTGTACGAAATCAATGATTTAGATCGACACAGCCCAAAAATTCTTAAAAACGCATTCAGCTTTAGGTTTGGTCTCGGAGATCTCGTCCCATTCACAAACAAACTCTACACCGGCGATCTCAAGAAACGCGTGGGAATCACGGCTGGTCTCTGCGTTGTGATCGAACACGTCCCTGAGAAGAACGGTGATAGATTCGAAGCTACGTACAGCTTCTACTTCGGAGACTATGGCCACTTGTCCGTACAAGGACCATACTTGACTTACGAGGATTCGTTCCTTGCCATCACTGGTGGCGCTGGAATCTTTGAAGGTGCCTACGGACAGGTTAAGCTTCAACAGCTTGTGTATCCGACAAAACTGTTCTACACTTTTTATCTTAAAGGATTGGCTAATGATTTGCCACTGGAGCTCATAGGAACTCCGGTACCACCGTCTAAGGACGTGGAGCCAGCACCGGAAGCTAAGGCGCTTAAGCCCAGTGGAGTTGTAAGCAACTTTACAAATTAGTGAATAAAATTAGTCTTATCTTTCTCGTGTCCTGTATATATAATAATCTTTTTCATAGAGAATTTTATATTCTTATACTTGTAATCAAATAATTTGTATGGATCTTAGTATCCTTGTGAATGCAGTATGTTTGAGTTGAAAAATACTTGTAATCGAATCTTTAGTTTTGAGTTGTCCCCTTTTGGGGAGTAAAATATCTTCTTCTTATTTTTATTGGGTTGAAAATAGGTTTT
CDS Sequence
- >AT3G25760.1 ATGGCTTCTTCTACAATCTCTCTCCAATCTATCTCCATGACAACTCTCAACAATCTCTCATATAGTAAACAATTTCATCGAAGCTCTCTTCTTGGTTTCTCTAAATCCTTCCAAAATTTTGGTATCTCATCTAACGGTCCAGGTTCCTCCTCTCCGACAAGTTTCACGCCCAAGAAGAAACTCACTCCTACTCGAGCTCTCTCTCAGAACTTGGGAAATACCGAAAACCCCAGACCAAGCAAAGTTCAAGAACTGAGCGTGTACGAAATCAATGATTTAGATCGACACAGCCCAAAAATTCTTAAAAACGCATTCAGCTTTAGGTTTGGTCTCGGAGATCTCGTCCCATTCACAAACAAACTCTACACCGGCGATCTCAAGAAACGCGTGGGAATCACGGCTGGTCTCTGCGTTGTGATCGAACACGTCCCTGAGAAGAACGGTGATAGATTCGAAGCTACGTACAGCTTCTACTTCGGAGACTATGGCCACTTGTCCGTACAAGGACCATACTTGACTTACGAGGATTCGTTCCTTGCCATCACTGGTGGCGCTGGAATCTTTGAAGGTGCCTACGGACAGGTTAAGCTTCAACAGCTTGTGTATCCGACAAAACTGTTCTACACTTTTTATCTTAAAGGATTGGCTAATGATTTGCCACTGGAGCTCATAGGAACTCCGGTACCACCGTCTAAGGACGTGGAGCCAGCACCGGAAGCTAAGGCGCTTAAGCCCAGTGGAGTTGTAAGCAACTTTACAAATTAG
Protein Sequence
- >AT3G25760.1 MASSTISLQSISMTTLNNLSYSKQFHRSSLLGFSKSFQNFGISSNGPGSSSPTSFTPKKKLTPTRALSQNLGNTENPRPSKVQELSVYEINDLDRHSPKILKNAFSFRFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVIEHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQLVYPTKLFYTFYLKGLANDLPLELIGTPVPPSKDVEPAPEAKALKPSGVVSNFTN