Gene Details:
- Gene ID: AT3G47710
- Gene Symbol: BHLH161, BNQ3, PRE4
- Gene Name: BASIC HELIX-LOOP-HELIX PROTEIN 161, BANQUO 3
- Description: BANQUO 3;(source:Araport11)
- TAIR Accession: locus:2100342
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Gene Ontology:
- GO:0005515 — enables — protein binding
- GO:0006355 — involved in — regulation of DNA-templated transcription
- GO:0046983 — enables — protein dimerization activity
- GO:0048510 — acts upstream of or within — regulation of timing of transition from vegetative to reproductive phase
- GO:0009640 — acts upstream of or within — photomorphogenesis
- GO:0005634 — located in — nucleus
- GO:0040008 — involved in — regulation of growth
- GO:0003700 — enables — DNA-binding transcription factor activity
Germplasm Phenotype:
- SALK_098881 homozygous — sepals and carpels are pale yellow or white,while the inflorescence stems and siliques are purple. Floral organs are smaller than WT. Flowers, cauline leaves, stems, and siliques have a decreased amount of chlorophyll as compared to WT.
- bnq1 rnai; bnq2 rnai; bnq3 — Same as bnq3 single mutants: sepals and carpels are pale yellow or white,while the inflorescence stems and siliques are purple
- bnq3 ap3-3 — Pale yellowish sepaloid second-whorl organs.
Literature:
- The basic helix-loop-helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity. DOI: 10.1093/molbev/msg088 ; PMID: 12679534
- Update on the basic helix-loop-helix transcription factor gene family in Arabidopsis thaliana. DOI: 10.1105/tpc.151140 ; PMID: 14600211
- Overexpression of PRE1 and its homologous genes activates Gibberellin-dependent responses in Arabidopsis thaliana. DOI: 10.1093/pcp/pcj026 ; PMID: 16527868
- KIDARI, encoding a non-DNA Binding bHLH protein, represses light signal transduction in Arabidopsis thaliana. DOI: 10.1007/s11103-006-0010-2 ; PMID: 16786307
- Regulation of Arabidopsis brassinosteroid signaling by atypical basic helix-loop-helix proteins. DOI: 10.1105/tpc.109.072504 ; PMID: 20023194
- Antagonistic HLH/bHLH transcription factors mediate brassinosteroid regulation of cell elongation and plant development in rice and Arabidopsis. DOI: 10.1105/tpc.109.070441 ; PMID: 20009022
- The Arabidopsis floral homeotic proteins APETALA3 and PISTILLATA negatively regulate the BANQUO genes implicated in light signaling. DOI: 10.1105/tpc.109.065946 ; PMID: 20305124
- The G-Box Transcriptional Regulatory Code in Arabidopsis. DOI: 10.1104/pp.17.01086 ; PMID: 28864470
- PACLOBUTRAZOL-RESISTANCE Gene Family Regulates Floral Organ Growth with Unequal Genetic Redundancy in Arabidopsis thaliana. DOI: 10.3390/ijms20040869 ; PMID: 30781591
- The basic helix-loop-helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity. DOI: 10.1093/molbev/msg088 ; PMID: 12679534
Sequence:
cDNA Sequence
- >AT3G47710.1 TTATTTTAAGCAGTTGCAGTAGACTCTTCCACTTCTGTATTCAATTCTTCCTTCTTTTTTCTCTTATAATATAAATAACATACAAAGAAAATACTTGCACTCACAAATATTGATTAAAGTTAATTAGTGAACCCTAAGATTTATAAATCTCTAGCTATACTCTACCATATCATATATATTACATAATGTCTAGCAGAAAATCACGTTCAAGACAAACTGGAGCTTCCATGATCACGGATGAACAAATCAACGATCTTGTCCTCCAGCTTCATCGGCTTCTCCCCGAACTTGCTAACAACAGACGCTCTGGAAAGGTTTCAGCATCAAGGGTATTACAAGAGACATGCAGTTACATAAGGAACTTGAGCAAAGAAGTGGATGATCTTAGTGAAAGATTGTCTCAACTTTTGGAATCAACTGATTCAGCTCAAGCTGCACTAATCCGAAGTTTGCTTATGCAGTAGAATTAGTGCAATAAACGAAGGATATTTTTTTCTTTTCTTTTTTTTGAAAAAATGTCTTCTCAGTTTTAATTCCCCTTCTTATTGTATTTATAATGTCTGGCAGCTTGTGTCCCCTGTTAATTATGCAATGTTTTATTTTTAATATATGTAGGGTTTTGTTTTTGTCAGTTGTTGAACGAAGCAAATGGTTTGGGTTTACGTTCACATTATTTAAG
CDS Sequence
- >AT3G47710.1 ATGTCTAGCAGAAAATCACGTTCAAGACAAACTGGAGCTTCCATGATCACGGATGAACAAATCAACGATCTTGTCCTCCAGCTTCATCGGCTTCTCCCCGAACTTGCTAACAACAGACGCTCTGGAAAGGTTTCAGCATCAAGGGTATTACAAGAGACATGCAGTTACATAAGGAACTTGAGCAAAGAAGTGGATGATCTTAGTGAAAGATTGTCTCAACTTTTGGAATCAACTGATTCAGCTCAAGCTGCACTAATCCGAAGTTTGCTTATGCAGTAG
Protein Sequence
- >AT3G47710.1 MSSRKSRSRQTGASMITDEQINDLVLQLHRLLPELANNRRSGKVSASRVLQETCSYIRNLSKEVDDLSERLSQLLESTDSAQAALIRSLLMQ