Gene Details:

Functional Descriptions:

  • Gain-of-function of the 1-aminocyclopropane-1-carboxylate synthase gene ACS1G induces female flower development in cucumber gynoecy.
  • Here, we created a set of mutants and revealed that ACS1G is responsible for gynoecy conferred by the F locus.
  • The duplication resulted in ACS1G acquiring a new promoter and expression pattern; in plants carrying the F locus duplication, ACS1G is expressed early in floral bud development, where it functions with ACO2 to generate an ethylene burst.
  • This early ACS1G expression bypasses the need for ACS11 to produce ethylene, thereby establishing a dominant pathway for female floral development. Based on these findings, we propose a model for how these ethylene biosynthesis genes cooperate to control unisexual flower development in cucumber.

Literature:

Gene Resources:

Sequences:

cDNA Sequence
  • />Csa_6G496960
    AAGAAGAAGATAGATCATCATGGGAAGAGCTCCTTGTTGTGACAAAGCCAATGTGAAAAAAGGTCCTTGGTCGCCTGAGGAAGATGCCAAACTCAAAGCTTATATTGACCAATTTGGCACCGGCGGTAACTGGATTGCCTTGCCTCAAAAAATAGGTAACTTCCAAGTTTCATTACAATATTTATAA
CDS Sequence
  • />Csa_6G496960
    ATGGGAAGAGCTCCTTGTTGTGACAAAGCCAATGTGAAAAAAGGTCCTTGGTCGCCTGAGGAAGATGCCAAACTCAAAGCTTATATTGACCAATTTGGCACCGGCGGTAACTGGATTGCCTTGCCTCAAAAAATAGGTAACTTCCAAGTTTCATTACAATATTTATAA
Protein Sequence
  • />Csa_6G496960
    MGRAPCCDKANVKKGPWSPEEDAKLKAYIDQFGTGGNWIALPQKIGNFQVSLQYL