Gene Details:
- Gene ID: Gh_D06G0145
- Gene Symbol: GhSCP2D
- Gene Name:
- Genome: TM1_NBI
- Species: Gossypium hirsutum
Functional Descriptions:
- GhSCP2D, a putative sterol carrier protein gene from elongating cotton (Gossypium hirsutum) fibers.
- Downregulation of GhSCP2D Shortens Fiber Length Due to the Reduced Sucrose and Hexose Levels.
- Sugar Contents in Fibers of GhSCP2D-Downregulated and Wild-Type Plants.
Function-related keywords:
Literature:
- Suppressing a Putative Sterol Carrier Gene Reduces Plasmodesmal Permeability and Activates Sucrose Transporter Genes during Cotton Fiber Elongation. DOI: 10.1105/tpc.17.00358 ; PMID: 28747422
Related News:
Gene Resources:
Sequences:
cDNA Sequence
CDS Sequence
- />Gh_D06G0145
ATGGCTGAGTTGAAATCTGACAATTTGCTTGAGATGATGAAGTTTCATTTGGGTACTGATGCTGGTAAAGAGCTTACTAAGAAGATTGGTCTTGTTTACCAACTCAATATTGCCCCCAAGAAATTGGGGGTTGATGAGGTTACTTACGTTGTTGATCTCAAGAAAGGAGATGTTATCAAAGGTGAATATGAAGGGGGAAAGCCTGATGTTATATTTTCATTCAAGGATGATGATTTTCTTAAGATTGCCACTGGGAAGATGAATCCCCAGGTTGCTTTTATGAGGTGCAATCCCTAA
Protein Sequence
- />Gh_D06G0145
MAELKSDNLLEMMKFHLGTDAGKELTKKIGLVYQLNIAPKKLGVDEVTYVVDLKKGDVIKGEYEGGKPDVIFSFKDDDFLKIATGKMNPQVAFMRCNP