Gene Details:
- MSU gene ID: LOC_Os01g64380
- RAPdb gene ID: None
- Gene Symbol: REL1
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- Electron microscope observations indicated that the leaf incurvations of REL1 dominant mutants result from the alteration of the size and number of bulliform cells.
- Alternatively, overexpression of REL1 in wild-type plants induced a phenotype similar to that of the dominant REL1 mutant, indicating that REL1 plays a positive role in leaf rolling and bending.
- Taken together, these findings suggest that REL1 regulates leaf morphology, particularly in leaf rolling and bending, through the coordination of BR signalling transduction.
- Consistent with the observed REL1 phenotype, the REL1 gene was predominantly expressed in the meristem of various tissues during plant growth and development.
- Nevertheless, the responsiveness of both REL1 dominant mutants and REL1-overexpressing plants to exogenous brassinosteroid (BR) was reduced.
- Moreover, transcript levels of BR response genes in the REL1 dominant mutants and REL1-overexpressing lines were significantly altered.
- Constitutive expression of REL1 confers the rice response to drought stress and abscisic acid.
- However, the role of REL1 in drought response is still poorly understood.
- Moreover, our results revealed that REL1-D was hypersensitive to ABA and the expression of ABA associated genes was significantly increased in REL1-D, suggesting that REL1 likely coordinates ABA to regulate drought response.
- Consistently, we also found that constitutive expression of REL1 alters the expression of biotic and abiotic stress responsive genes by the isobaric tags for relative and absolute quantification (iTRAQ) analysis.
Function-related keywords:
- leaf , growth , development , meristem , brassinosteroid , BR , plant-growth , leaf-rolling , drought , abiotic-stress , ABA , stress , biotic-stress , drought-stress , abscisic-acid
Literature:
- Characterization of Rolled and Erect Leaf 1 in regulating leave morphology in rice . DOI: 10.1093/jxb/erv319 ; PMID: 26142419
- Constitutive expression of REL1 confers the rice response to drought stress and abscisic acid . DOI: 10.1186/s12284-018-0251-0 ; PMID: 30361842
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os01g64380.1 cDNA ATGGGCGGCCCCGCGCCGCCGCCCGCCGCGTCCGGGCTGCCCTCCGACGACACGCACGAGCTCGGCGGCGACGCGGTGGACGACGACGAGGACGACAGCCTGCGCGGCGACGTGTTCGCGCCGTTGACGCCGCCGCTGTCGCCGCCCGGGCGCACAGTCGCCGACGGCCCGCCGCCGCCGCCGCCACGCGCCCTCGACAGGCTCATCAGCCTCAGGCACTCCAGCTTGGAACTCTTGCCGTTGTTCCTGCTCATCCTCGCCGCCTCCACCAACACCACCTCCGATCACTGCACTCAGCTACGCCAACAACATTAG
CDS Sequence
- >LOC_Os01g64380.1 CDS ATGGGCGGCCCCGCGCCGCCGCCCGCCGCGTCCGGGCTGCCCTCCGACGACACGCACGAGCTCGGCGGCGACGCGGTGGACGACGACGAGGACGACAGCCTGCGCGGCGACGTGTTCGCGCCGTTGACGCCGCCGCTGTCGCCGCCCGGGCGCACAGTCGCCGACGGCCCGCCGCCGCCGCCGCCACGCGCCCTCGACAGGCTCATCAGCCTCAGGCACTCCAGCTTGGAACTCTTGCCGTTGTTCCTGCTCATCCTCGCCGCCTCCACCAACACCACCTCCGATCACTGCACTCAGCTACGCCAACAACATTAG
Protein Sequence
- >LOC_Os01g64380.1 protein MGGPAPPPAASGLPSDDTHELGGDAVDDDEDDSLRGDVFAPLTPPLSPPGRTVADGPPPPPPRALDRLISLRHSSLELLPLFLLILAASTNTTSDHCTQLRQQH*