Gene Details:

Functional Descriptions:

  • Electron microscope observations indicated that the leaf incurvations of REL1 dominant mutants result from the alteration of the size and number of bulliform cells.
  • Alternatively, overexpression of REL1 in wild-type plants induced a phenotype similar to that of the dominant REL1 mutant, indicating that REL1 plays a positive role in leaf rolling and bending.
  • Taken together, these findings suggest that REL1 regulates leaf morphology, particularly in leaf rolling and bending, through the coordination of BR signalling transduction.
  • Consistent with the observed REL1 phenotype, the REL1 gene was predominantly expressed in the meristem of various tissues during plant growth and development.
  • Nevertheless, the responsiveness of both REL1 dominant mutants and REL1-overexpressing plants to exogenous brassinosteroid (BR) was reduced.
  • Moreover, transcript levels of BR response genes in the REL1 dominant mutants and REL1-overexpressing lines were significantly altered.
  • Constitutive expression of REL1 confers the rice response to drought stress and abscisic acid.
  • However, the role of REL1 in drought response is still poorly understood.
  • Moreover, our results revealed that REL1-D was hypersensitive to ABA and the expression of ABA associated genes was significantly increased in REL1-D, suggesting that REL1 likely coordinates ABA to regulate drought response.
  • Consistently, we also found that constitutive expression of REL1 alters the expression of biotic and abiotic stress responsive genes by the isobaric tags for relative and absolute quantification (iTRAQ) analysis.

Literature:

Gene Resources:

  • NCBI ID:
  • UniProt accessions:

Sequences:

cDNA Sequence
  • >LOC_Os01g64380.1 cDNA ATGGGCGGCCCCGCGCCGCCGCCCGCCGCGTCCGGGCTGCCCTCCGACGACACGCACGAGCTCGGCGGCGACGCGGTGGACGACGACGAGGACGACAGCCTGCGCGGCGACGTGTTCGCGCCGTTGACGCCGCCGCTGTCGCCGCCCGGGCGCACAGTCGCCGACGGCCCGCCGCCGCCGCCGCCACGCGCCCTCGACAGGCTCATCAGCCTCAGGCACTCCAGCTTGGAACTCTTGCCGTTGTTCCTGCTCATCCTCGCCGCCTCCACCAACACCACCTCCGATCACTGCACTCAGCTACGCCAACAACATTAG
CDS Sequence
  • >LOC_Os01g64380.1 CDS ATGGGCGGCCCCGCGCCGCCGCCCGCCGCGTCCGGGCTGCCCTCCGACGACACGCACGAGCTCGGCGGCGACGCGGTGGACGACGACGAGGACGACAGCCTGCGCGGCGACGTGTTCGCGCCGTTGACGCCGCCGCTGTCGCCGCCCGGGCGCACAGTCGCCGACGGCCCGCCGCCGCCGCCGCCACGCGCCCTCGACAGGCTCATCAGCCTCAGGCACTCCAGCTTGGAACTCTTGCCGTTGTTCCTGCTCATCCTCGCCGCCTCCACCAACACCACCTCCGATCACTGCACTCAGCTACGCCAACAACATTAG
Protein Sequence
  • >LOC_Os01g64380.1 protein MGGPAPPPAASGLPSDDTHELGGDAVDDDEDDSLRGDVFAPLTPPLSPPGRTVADGPPPPPPRALDRLISLRHSSLELLPLFLLILAASTNTTSDHCTQLRQQH*