Gene Details:

Functional Descriptions:

  • Light and near-infrared confocal microscopy of cross-sections through developing flowers of male-sterile transgenics shows that tissue-specific expression of barnase or the antisense RTS genes interrupts tapetal development, resulting in deformed non-viable pollen.
  • These results demonstrate a critical role of the RTS gene in pollen development in rice and the versatile application of the RTS gene promoter in directing anther-specific gene expression in both monocotyledonous and dicotyledonous plants, pointing to a potential for exploiting this gene and its promoter for engineering male sterility for hybrid production of various plant species.
  • A tapetum-specific gene, RTS, has been isolated by differential screening of a cDNA library from rice panicles.
  • Transgenic and antisense RNA approaches revealed that RTS gene is required for male fertility in rice.
  • RTS, a rice anther-specific gene is required for male fertility and its promoter sequence directs tissue-specific gene expression in different plant species.
  • Several other sequence motifs found in other anther-specific promoters were also identified in the promoter of the RTS gene.

Literature:

Gene Resources:

  • NCBI ID: U12171
  • UniProt accessions:

Sequences:

cDNA Sequence
  • >LOC_Os01g70440.1 cDNA TGCATCATCATCATCAGCTCGATAGAAAAAGAAAGAAATTAAAAAGAAAATCACGGCGCGTGAGCTTGCAGAGACAGCAATGGTGAGAGTTGGTGCCGCCGCGGCGGTGCTCGTGCTGGCGGCGGCGGCGGCGGCCATGGCCGCCGAGCCGCCCACCGATGACGGCGCGGTCCGGGTGGCGGCGGGGCTGACGAAGTGCGTGTCCGGGTGCGGTAGCAAGGTGACCTCCTGCTTGCTCGGCTGCTACGGCGGCGGCGGCGGCGCCGCCGCCGCCGCGACGGCGATGCCGTTCTGCGTCATCGGCTGCACCAGCGACGTCTTGTCCTGCGCCACCGGCTGCTCCACCTCGCTCTGATTAAGTACTAATGAAGTAATTAACCGCGCTAATTAATAATAAATCGCACCTACGTATGCCACATGTGGACTCGCTTGACTAATTAAATACTGCCATGCGAATGCGATTAGTGGATTATGAAAAGAGGAAATGTAAGAACTCATGGCTCTCTCTGTGCCATGCCTGTACTGCATTGAAATGAATCTGCATGCAGCCATGAACTGATATACAAATACGACCATGTTACCTGTAATCTCTCCATCATGTGGGGCTTTCATGCTTTAATAACGTGTGATATTGATATTATGTGATTAATTGT
CDS Sequence
  • >LOC_Os01g70440.1 CDS ATGGTGAGAGTTGGTGCCGCCGCGGCGGTGCTCGTGCTGGCGGCGGCGGCGGCGGCCATGGCCGCCGAGCCGCCCACCGATGACGGCGCGGTCCGGGTGGCGGCGGGGCTGACGAAGTGCGTGTCCGGGTGCGGTAGCAAGGTGACCTCCTGCTTGCTCGGCTGCTACGGCGGCGGCGGCGGCGCCGCCGCCGCCGCGACGGCGATGCCGTTCTGCGTCATCGGCTGCACCAGCGACGTCTTGTCCTGCGCCACCGGCTGCTCCACCTCGCTCTGA
Protein Sequence
  • >LOC_Os01g70440.1 protein MVRVGAAAAVLVLAAAAAAMAAEPPTDDGAVRVAAGLTKCVSGCGSKVTSCLLGCYGGGGGAAAAATAMPFCVIGCTSDVLSCATGCSTSL*