Gene Details:
- MSU gene ID: LOC_Os02g44310
- RAPdb gene ID: Os02g0662000
- Gene Symbol: RCc3
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- Overexpression of RCc3 improves root system architecture and enhances salt tolerance in rice.
- In this study, we investigated the biological role of the rice root-specific gene RCc3 in improving root growth and responses to abiotic stress by overexpressing RCc3 in rice plants.
- RCc3 overexpression produced pleiotropic phenotypes of improved root system architecture, including increased growth of primary root, adventitious roots and lateral roots at the seedling stage.
- Further study indicated that auxin accumulation in the root was increased through auxin local biosynthesis and polar auxin transport in RCc3 overexpression lines.
- Under osmotic and heat stress conditions, the root and shoot growth were less severely inhibited in RCc3 overexpressing transgenic plants than that in wild-type plants, and the transcript levels of abiotic stress-related genes were significantly increased.
- Taken together, the data showed that RCc3 overexpression can improve rice root system, promote plant growth, and enhance plant tolerance to salt stress.
- Moreover, overexpression of RCc3 remarkably enhanced the tolerance to salt stress, with the elevated activities of antioxidant enzymes.
- RCc3 was induced by osmotic and heat stress.
Function-related keywords:
- root , growth , shoot , seedling , salt , tolerance , abiotic-stress , auxin , salt-tolerance , salt-stress , stress , architecture , biotic-stress , auxin-transport , lateral-root , adventitious-root , primary-root , plant-growth , root-system-architecture
Literature:
- Overexpression of RCc3 improves root system architecture and enhances salt tolerance in rice . DOI: 10.1016/j.plaphy.2018.08.008 ; PMID: 30103148
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os02g44310.1 cDNA ATCTCAAGCAGCCTAATCATCTCCAGCTGATCAAGAGCTCTTAATTAGCTAGCTAGTGATTAGCTGCGCTTGTGATCGATCGATCTCGGGTACGTAGCAATGGCGTCCAAGGCGTTCGCTCTGTTCCTGGCCGTGAACCTCGTCGTGCTCGGGGTGGCAAGCGCCTGCGGCGGCAGCCCGTCGTGCCCGACGCCGACGCCGTCGACCCCGACACCGTCAACGCCGACGCCGACGCCGTCGGCGTTCGGGAGGTGCCCCCGCGACGCGCTGAAGCTGGGCGTGTGCGCCAACGTGCTGGGCCTGATCAAGGCCAAGGTGGGCGTGCCTCCGGCGGAGCCGTGCTGCCCGCTGCTGGAGGGGCTCGTCGACCTCGAGGCGGCGGTGTGCCTCTGCACGGCCATCAGGGGCAACATCCTCGGAATCAACCTCAACCTCCCCATCGACCTCAGCCTCATCCTCAACTACTGCGGCAAGACCGTCCCCACCGGCTTCAAGTGCTAAGCAGCGTGCATATGCAATGCCTGCATGGGTTGATCCTACGTACGGTGATTAGTTGGCTTTGACGACTCTTGATTTGATTTGCTTGCTGCTCTGTTTATTTGCTACTACGTTACGTACGTACTTTGCATGCAACGCAACGCATGATCGATCGTGCATGCTGGCTGTTTGTACGTATCACGGTACCAGTTTGGATTCTCTCTGTACTCTCTCCTTTGTCTTCTTTGTAGTACTCTTATTCCCGCTATCCGTACGTGCGCATTTGTTGTAAGGGCCGGTGCTAGCTTGTGTGCCGGTACCAACTTCTAATAAAGCTTTGGTTTGCAACTTCAGATATATA
CDS Sequence
- >LOC_Os02g44310.1 CDS ATGGCGTCCAAGGCGTTCGCTCTGTTCCTGGCCGTGAACCTCGTCGTGCTCGGGGTGGCAAGCGCCTGCGGCGGCAGCCCGTCGTGCCCGACGCCGACGCCGTCGACCCCGACACCGTCAACGCCGACGCCGACGCCGTCGGCGTTCGGGAGGTGCCCCCGCGACGCGCTGAAGCTGGGCGTGTGCGCCAACGTGCTGGGCCTGATCAAGGCCAAGGTGGGCGTGCCTCCGGCGGAGCCGTGCTGCCCGCTGCTGGAGGGGCTCGTCGACCTCGAGGCGGCGGTGTGCCTCTGCACGGCCATCAGGGGCAACATCCTCGGAATCAACCTCAACCTCCCCATCGACCTCAGCCTCATCCTCAACTACTGCGGCAAGACCGTCCCCACCGGCTTCAAGTGCTAA
Protein Sequence
- >LOC_Os02g44310.1 protein MASKAFALFLAVNLVVLGVASACGGSPSCPTPTPSTPTPSTPTPTPSAFGRCPRDALKLGVCANVLGLIKAKVGVPPAEPCCPLLEGLVDLEAAVCLCTAIRGNILGINLNLPIDLSLILNYCGKTVPTGFKC*