Gene Details:
- MSU gene ID: LOC_Os03g43480
- RAPdb gene ID: Os03g0635100
- Gene Symbol: RGG1
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- Function of heterotrimeric G-protein gamma subunit RGG1 in providing salinity stress tolerance in rice by elevating detoxification of ROS.
- The present study provides evidence of a unique function of RGG1 in providing salinity stress tolerance in transgenic rice without affecting yield.
- The overexpression of RGG1 driven by the CaMV35S promoter in transgenic rice conferred high salinity tolerance even in the presence of 200<U+00A0>mM NaCl.
- Our study demonstrates that simultaneous overexpression of RGB1 and RGG1 genes provides multiple stress tolerance in rice by inducing stress responsive genes and better management of ROS scavenging/photosynthetic machineries.
- Overexpression of RGG1 in Nipponbare (NIP) and Wuyunjing 30 (WYJ30) significantly decreased plant height, panicle length and grain length by regulating cell division.
Function-related keywords:
- salinity , tolerance , yield , salinity-stress , stress , stress-tolerance , panicle , grain , grain-length , cell-division , plant-height , panicle-length
Literature:
- Function of heterotrimeric G-protein γ subunit RGG1 in providing salinity stress tolerance in rice by elevating detoxification of ROS . DOI: 10.1007/s00425-016-2614-3 ; PMID: 27785615
- Concurrent overexpression of rice G-protein β and γ subunits provide enhanced tolerance to sheath blight disease and abiotic stress in rice . DOI: 10.1007/s00425-019-03241-z ; PMID: 31332521
- RGG1, Involved in the Cytokinin Regulatory Pathway, Controls Grain Size in Rice . DOI: 10.1186/s12284-020-00436-x ; PMID: 33169285
Related News:
Gene Resources:
- NCBI ID: GU111573
- UniProt accessions:
Sequences:
cDNA Sequence
- >LOC_Os03g43480.1 cDNA ATGCAGGCCGGAGGAGGAGGGGACGCCGGGGACACGCGGGGGCGGCACCGGATCCAGGCGGAGCTCAAGAAGCTCGAGCAAGAGGCGCGCTTTCTCGAGGATCTATACCAGAGCCCAGAGAAACAAAAGTGCTCTTCTGTGTCATCTAATGATTGGGGACTGACAGTGTACTCAAGAGTGAAGACTGCTTCAGGGATACTACTGAATACTGATGCCCCTTCCTGGGGACCTGTTTAG
CDS Sequence
- >LOC_Os03g43480.1 CDS ATGCAGGCCGGAGGAGGAGGGGACGCCGGGGACACGCGGGGGCGGCACCGGATCCAGGCGGAGCTCAAGAAGCTCGAGCAAGAGGCGCGCTTTCTCGAGGATCTATACCAGAGCCCAGAGAAACAAAAGTGCTCTTCTGTGTCATCTAATGATTGGGGACTGACAGTGTACTCAAGAGTGAAGACTGCTTCAGGGATACTACTGAATACTGATGCCCCTTCCTGGGGACCTGTTTAG
Protein Sequence
- >LOC_Os03g43480.1 protein MQAGGGGDAGDTRGRHRIQAELKKLEQEARFLEDLYQSPEKQKCSSVSSNDWGLTVYSRVKTASGILLNTDAPSWGPV*