Gene Details:
- MSU gene ID: LOC_Os03g50140
- RAPdb gene ID: Os03g0709100
- Gene Symbol: OsUCL8
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- The knock down or knock out of OsUCL8 also increases grain yield, while the overexpression of OsUCL8 results in an opposite phenotype.
- Further studies revealed that the cleavage of OsUCL8 by miR408 affects copper homeostasis in the plant cell, which in turn affects the abundance of plastocyanin proteins and photosynthesis in rice.
- Spatial and temporal expression analyses showed that OsUCL8 was highly expressed in pistils, young panicles, developing seeds and inflorescence meristem, and was nearly complementary to that of OsmiR408.
- Interestingly, the OsUCL8 protein was localized to the cytoplasm, distinctive from a majority of phytocyanins which localize to the plasma membrane.
- The overexpression of OsUCL8 led to a striking irregularity in pollen tube growth and pollination and thus affected the seed setting rate in rice; many pollen tubes appeared to lose the ability to grow directly into the style.
- The rice plantacyanin family member OsUCL8 plays an important role in pollen tube formation and growth and, in turn, regulates fertility and the seed setting rate.
- We further demonstrated that OsUCL8 mainly affects pollen intine formation.
- The addition of Vitamin B1 (VB1) significantly contributed to the germination of OXUCL8 pollen grains, suggesting that OsUCL8 could be associated with VB1 production.
Function-related keywords:
- grain , photosynthesis , grain-yield , inflorescence , homeostasis , plasma-membrane , copper , growth , pollen , seed , fertility
Literature:
- MiR408 Regulates Grain Yield and Photosynthesis via a Phytocyanin Protein . DOI: 10.1104/pp.17.01169 ; PMID: 28904074
- Rice UCL8, a plantacyanin gene targeted by miR408, regulates fertility by controlling pollen tube germination and growth . DOI: 10.1186/s12284-018-0253-y ; PMID: 30456598
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os03g50140.1 cDNA GGCATTGGCAACCAGCCAGCCTCCAGCTACACACTGACACTGCACTCCAGCCTCCGTAGGAGTACTTCAGCTCACTATAGAATGGCAACGGCAATGGCATCGTTACCTCCAGGCCCCAGCTAGTGCAGAGATTTCTCTTCCTTTGCCCAGTTTCCAGGCAGAAGCATCAGGCCAAGAGCTCAAGACCCAACCAGTGTAGTGGTTGCAGTCAGTGAGTGAGTGAGTGACCAGTGAGATAGTGGCATCGATGGCTCGGGGAAGAGGCAGTGCAATGCGAGGCGCCGTCGCCGTCGCGTTTCTCGCCGTCGTCGTGAGCTGCATCTTCCTCTCCGGCTGCGGCGTCGCCGACGCCGCCACCTACTACGTCGGCGACAGCCTCGGCTGGTCCCTCGGCAGCGGGAGCTGGCCCAGCGGCAAGAAGTTCCACGCCGGCGACATCCTCGTGTTCAGGTACTTGCCGTGGATGCACAACGTGGTGGCCGTCGACGAAGACGGGTACGCCGACTGCAACCCGCCGCCGTTCTCGAGGTACTACACCTCCGGCTCCGACAGCGTCAGGCTCGCCAGGGGGGACAACTTCTTCGTCTGCACCCGCTACGGCCACTGCAACCTCGGCATGAAGATGGTCGTCACCGCCGTGTGACTGAGGGAGAAACATGTCAAGACTGTTTCGTACGTCTCGATCGAGCGAAAATGCTGTGAAATGTCACACTCTCTCTATCTTGTTCCATCCGGTTCGTTCTCAGTTTTTAGCATTTTGGATGATTGATTAGAGGATTCTCTAGCTGTTCTATGCCGGTGTGACACGACTCGGTTTGCCAATTGTGTGTGCATTGTTGACGCTGACAAGATGCGTTTGTTCTGAAATCTGAAGAGAAGTCCCTGTCTTTGCCACTGATGATGATATCTACTGCAAATTCTTTAGCGAAGATA
CDS Sequence
- >LOC_Os03g50140.1 CDS ATGGCTCGGGGAAGAGGCAGTGCAATGCGAGGCGCCGTCGCCGTCGCGTTTCTCGCCGTCGTCGTGAGCTGCATCTTCCTCTCCGGCTGCGGCGTCGCCGACGCCGCCACCTACTACGTCGGCGACAGCCTCGGCTGGTCCCTCGGCAGCGGGAGCTGGCCCAGCGGCAAGAAGTTCCACGCCGGCGACATCCTCGTGTTCAGGTACTTGCCGTGGATGCACAACGTGGTGGCCGTCGACGAAGACGGGTACGCCGACTGCAACCCGCCGCCGTTCTCGAGGTACTACACCTCCGGCTCCGACAGCGTCAGGCTCGCCAGGGGGGACAACTTCTTCGTCTGCACCCGCTACGGCCACTGCAACCTCGGCATGAAGATGGTCGTCACCGCCGTGTGA
Protein Sequence
- >LOC_Os03g50140.1 protein MARGRGSAMRGAVAVAFLAVVVSCIFLSGCGVADAATYYVGDSLGWSLGSGSWPSGKKFHAGDILVFRYLPWMHNVVAVDEDGYADCNPPPFSRYYTSGSDSVRLARGDNFFVCTRYGHCNLGMKMVVTAV*