Gene Details:
- MSU gene ID: LOC_Os03g62420
- RAPdb gene ID: Os03g0840900
- Gene Symbol: DVB1
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- Map-based cloning, genetic complementation, and phylogenetic analysis revealed that DVB1 encodes a structural protein classified in the Mic10 family and is required for the formation of cristae in mitochondria, and was primarily expressed in vascular bundles.
- Comparing with the wild type, disruption of amino acid metabolism and increased auxin synthesis were observed in DVB1 mutant which also showed increased sensitivity to the mitochondrial electron transport inhibitors.
- Further studies indicated that DVB1 is important for mitochondrial and plant development in rice.
- The DVB1 protein is partially localized in the mitochondria and capable of forming dimers and polymers.
- CONCLUSIONS: DVB1 belongs to Mic10 family and DVB1 is partially localized in the mitochondria.
Function-related keywords:
Literature:
- Decreased Vascular Bundle 1 affects mitochondrial and plant development in rice . DOI: 10.1186/s12284-021-00454-3 ; PMID: 33492479
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os03g62420.1 cDNA ATGGCGGAGTCGCCCGAGAACGCCGCCCCGGCCGCGGCTCCGGCCCCAGCGCCCGCGCCCACCCCGGCCCCGCCGCCGCCGCCGTCATCTCCGCCCACCAAGTCGGGGATCCCGCCGCGGTACGACCTGGACGCCAAGTGGGACGCCTGCCTCGACATCTCCATCCGCCGCGTCGCCTACTCCACCCTGGGTGGCACCTTCGCGGGCCTCCTCCTCTTCCGTAGCCCAACTACTCGCTGGGCATCAGTTGCGCTCGGAGCTGGTGTGGGGATAGGAGCTGCGTACACTGAATGTTCATACTTATTCAATGGTGCTCCTCCAAAGTGGTCACCCAAAGTTTCGACCGTTCCTTCTGCTCATTCTGAAGGGGAAGACAAGTAA
CDS Sequence
- >LOC_Os03g62420.1 CDS ATGGCGGAGTCGCCCGAGAACGCCGCCCCGGCCGCGGCTCCGGCCCCAGCGCCCGCGCCCACCCCGGCCCCGCCGCCGCCGCCGTCATCTCCGCCCACCAAGTCGGGGATCCCGCCGCGGTACGACCTGGACGCCAAGTGGGACGCCTGCCTCGACATCTCCATCCGCCGCGTCGCCTACTCCACCCTGGGTGGCACCTTCGCGGGCCTCCTCCTCTTCCGTAGCCCAACTACTCGCTGGGCATCAGTTGCGCTCGGAGCTGGTGTGGGGATAGGAGCTGCGTACACTGAATGTTCATACTTATTCAATGGTGCTCCTCCAAAGTGGTCACCCAAAGTTTCGACCGTTCCTTCTGCTCATTCTGAAGGGGAAGACAAGTAA
Protein Sequence
- >LOC_Os03g62420.1 protein MAESPENAAPAAAPAPAPAPTPAPPPPPSSPPTKSGIPPRYDLDAKWDACLDISIRRVAYSTLGGTFAGLLLFRSPTTRWASVALGAGVGIGAAYTECSYLFNGAPPKWSPKVSTVPSAHSEGEDK*