Gene Details:
- MSU gene ID: LOC_Os05g04700
- RAPdb gene ID: Os05g0138300
- Gene Symbol: OsLti6b ddOs32
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- Over-expression of OsLti6b increased cold tolerance as revealed by seedling wilting rates and ion leakages of mature leaves, demonstrating that the extent of the tolerance correlates well with its expression level.
- Isolation of cold stress-responsive genes in the reproductive organs, and characterization of the OsLti6b gene from rice (Oryza sativa L.).
- Two closely related genes (OsLti6a, OsLti6b), which are induced by low temperature during seedling emergence were isolated from a cold tolerant temperate japonica rice cultivar.
Function-related keywords:
Literature:
- Characterization of two plasma membrane protein 3 genes (PutPMP3) from the alkali grass, Puccinellia tenuiflora, and functional comparison of the rice homologues, OsLti6a/b from rice . DOI: 10.5483/bmbrep.2008.41.6.448 ; PMID: 18593528
- The OsLti6 genes encoding low-molecular-weight membrane proteins are differentially expressed in rice cultivars with contrasting sensitivity to low temperature . DOI: 10.1016/j.gene.2004.09.033 ; PMID: 15656983
- Isolation of cold stress-responsive genes in the reproductive organs, and characterization of the OsLti6b gene from rice (Oryza sativa L.) . DOI: 10.1007/s00299-006-0297-0 ; PMID: 17219102
Related News:
Gene Resources:
- NCBI ID: AY607690
- UniProt accessions:
Sequences:
cDNA Sequence
- >LOC_Os05g04700.1 cDNA ATGGCGGGAACGGCGAACTGCATCGACATCCTCATCGCCATCATCCTCCCGCCCCTCGGCGTCTTCCTCAAGTTCGGATGCGGGCATGAGTTCTGGATCTGCCTGTTGCTCACCTTCCTCGGCTACATCCCCGGCATCATCTACGCCATCTACGCCATCACCAAGGATGGGCTCCAAACCGCTTCATCTATCTTCTCGATTGCCGTGTGCTTGTTGGAATTTGGAAATGATATATGCATCCAAAATTCAGTCCTGAGTGCTCCAATTCTTGTCATCTAG
CDS Sequence
- >LOC_Os05g04700.1 CDS ATGGCGGGAACGGCGAACTGCATCGACATCCTCATCGCCATCATCCTCCCGCCCCTCGGCGTCTTCCTCAAGTTCGGATGCGGGCATGAGTTCTGGATCTGCCTGTTGCTCACCTTCCTCGGCTACATCCCCGGCATCATCTACGCCATCTACGCCATCACCAAGGATGGGCTCCAAACCGCTTCATCTATCTTCTCGATTGCCGTGTGCTTGTTGGAATTTGGAAATGATATATGCATCCAAAATTCAGTCCTGAGTGCTCCAATTCTTGTCATCTAG
Protein Sequence
- >LOC_Os05g04700.1 protein MAGTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITKDGLQTASSIFSIAVCLLEFGNDICIQNSVLSAPILVI*