Gene Details:
- MSU gene ID: LOC_Os05g04900
- RAPdb gene ID: None
- Gene Symbol: WLS5
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- A 3-bp deletion of WLS5 gene leads to weak growth and early leaf senescence in rice.
- Knockout of LOC_Os05g04900 in Nipponbare plants caused leaf senescence, confirming this locus as the causal gene for WLS5.
- Further molecular study of WLS5 will uncover the roles of this gene in plant growth and leaf senescence.
- Histological analysis showed that the poor growth of WLS5 plants involved a reduction in cell length and number.
- The WLS5 mutants also exhibited significantly higher stomatal density and altered phytohormone contents compared with wild-type plants.
- Physiological analysis and transmission electron microscopy revealed that the WLS5 cells had abnormal chloroplasts, and the mutants underwent chlorophyll degradation triggered by accumulation of reactive oxygen species.
Function-related keywords:
- leaf , leaf-senescence , early-leaf-senescence , senescence , growth , stomatal , phytohormone , reactive-oxygen-species , plant-growth
Literature:
- A 3-bp deletion of WLS5 gene leads to weak growth and early leaf senescence in rice . DOI: 10.1186/s12284-019-0288-8 ; PMID: 31037442
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os05g04900.1 cDNA ATGGATTCATCTGCTGCGGATGGTGAGACGAAGGAGGAGTCGTCGAAAGTGAAGATGTTGCTGCCGGAAGATTTCCTCAACACCGTCCTCCTCTGCACTGCTTTCTTGTACAAGGCGATGAATACCATCGGCACGCTGGCCACCATCTGGGCGACCGTCGTCCTGCTCGGTGGATTCTCCACCCTCATCAAGAAGGAGGACTTTTGGTACGTCACCGTCATCGCCTTCGTCCAATCCATCGGAATACTGGTTAAGCAGTAA
CDS Sequence
- >LOC_Os05g04900.1 CDS ATGGATTCATCTGCTGCGGATGGTGAGACGAAGGAGGAGTCGTCGAAAGTGAAGATGTTGCTGCCGGAAGATTTCCTCAACACCGTCCTCCTCTGCACTGCTTTCTTGTACAAGGCGATGAATACCATCGGCACGCTGGCCACCATCTGGGCGACCGTCGTCCTGCTCGGTGGATTCTCCACCCTCATCAAGAAGGAGGACTTTTGGTACGTCACCGTCATCGCCTTCGTCCAATCCATCGGAATACTGGTTAAGCAGTAA
Protein Sequence
- >LOC_Os05g04900.1 protein MDSSAADGETKEESSKVKMLLPEDFLNTVLLCTAFLYKAMNTIGTLATIWATVVLLGGFSTLIKKEDFWYVTVIAFVQSIGILVKQ*