Gene Details:
- MSU gene ID: LOC_Os05g28210
- RAPdb gene ID: Os05g0349800
- Gene Symbol: OsEm EMP1 OsEm1
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- A fusion gene (OsEm-GUS) consisting of the OsEm promoter and the bacterial beta-glucuronidase (GUS) gene was constructed and tested in a transient expression system, using protoplasts derived from a suspension-cultured line of rice cells, for activation by ABA and by co-transfection with an expression vector (35S-Osvp1) for the rice VP1 (OSVP1) cDNA.
- The expression of OsEm-GUS was strongly (40- to 150-fold) activated by externally applied ABA and by over-expression of (OS)VP1.
- Overexpression of OsEm1 encoding a group I LEA protein confers enhanced drought tolerance in rice.
- In an effort to identify rice genes responsible for drought tolerance, a drought-responsive gene OsEm1 encoding a group I LEA protein, was chosen for this study.
- In this study, we generated OsEm1-overexpressing rice plants to explore the function of OsEm1 under drought conditions.
- Our findings suggest that OsEm1 is a positive regulator of drought tolerance and is potentially promising for engineering drought tolerance in rice.
- Overexpression of OsEm1 increases ABA sensitivity and enhances osmotic tolerance in rice.
- OsEm1 was shown at vegetative stages to be responsive to various abiotic stresses, including drought, salt, cold and the hormone ABA.
- Compared with wild type, the OsEm1-overexpressing rice plants showed enhanced plant survival ratio at the vegetative stage; moreover, over expression of OsEm1 in rice increased the expression of other LEA genes, including RAB16A, RAB16C, RAB21, and LEA3, likely protecting organ integrity against harsh environments.
Function-related keywords:
Literature:
- Nucleotide sequence of the rice (Oryza sativa) Em protein gene (Emp1) . DOI: 10.1007/BF00027357 ; PMID: 1623185
- Gibberellin is not a regulator of miR156 in rice juvenile-adult phase change . DOI: 10.1186/1939-8433-5-25 ; PMID: 24279896
- Regulation of the Osem gene by abscisic acid and the transcriptional activator VP1: analysis of cis-acting promoter elements required for regulation by abscisic acid and VP1 . DOI: 10.1046/j.1365-313x.1995.07060913.x ; PMID: 7599651
- Overexpression of OsEm1 encoding a group I LEA protein confers enhanced drought tolerance in rice . DOI: 10.1016/j.bbrc.2016.08.010 ; PMID: 27524243
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os05g28210.1 cDNA ATCAGCTCAAGCCGCAGAAGACATACACACACAAACACAAGCCACCCTTCCGATTTGTTCATCGATCAGTTCGCAGCGTACGTCAGGCTAGCTAACTAGTGTTTGGCAATGGCGTCCGGGCAGCAGCAGCAGGGCAGGTCGGAGCTGGACCGCATGGCCAGGGAGGGCCAGACCGTCGTCCCCGGCGGCACCGGCGGCAAGAGCCTCGAGGCCCAGGAGAACCTCGCCGAGGGGCGCAGCCGCGGGGGGCAGACGAGGAAGGAGCAGATGGGGGAGGAAGGGTACCGCGAGATGGGGCGCAAGGGCGGCCTCAGCACCGGCGACGAGTCCGGCGGCGAGCGCGCCGCCCGCGAGGGCATCGACATCGACGAGTCCAAGTACAAGACCAAGTCCTAGACTACACACACTTTTGCATCCGTGAATGCCAGTGTGTCGTAGTCGTCTCAGTTGTAGTCATCGAGTCAGTCTTAGCTAGCTAGCTCTCTTATCAATAATAATGTAGGTCTTGACGGATGCACGCATTTAGGCGCCCGTATGATTTGCTATGTTATGTTTCATATGGTGATGCGTGCTTAGCTTTAGCTAGCTTTGGTAGTTTGGTTTAGGTGCTGATCGATCATGGTCAGTAGCTAGGGTATGTGTTTTAGTTTATTGCAGGATCGGTCAGGCAGGGGCTGAATGCTAGCTAGGTGATGCTTTGGCTTTTCATGGCCAGCAGCTGCTAGCTTCTTGTTTCCAACTGATGCCTCTGCTGGGTGTGTCCTTTGTAACCGTGCTTGCTTTCAGTTAATCTAGCTAGCTGTTGTTCATCCGAAA
CDS Sequence
- >LOC_Os05g28210.1 CDS ATGGCGTCCGGGCAGCAGCAGCAGGGCAGGTCGGAGCTGGACCGCATGGCCAGGGAGGGCCAGACCGTCGTCCCCGGCGGCACCGGCGGCAAGAGCCTCGAGGCCCAGGAGAACCTCGCCGAGGGGCGCAGCCGCGGGGGGCAGACGAGGAAGGAGCAGATGGGGGAGGAAGGGTACCGCGAGATGGGGCGCAAGGGCGGCCTCAGCACCGGCGACGAGTCCGGCGGCGAGCGCGCCGCCCGCGAGGGCATCGACATCGACGAGTCCAAGTACAAGACCAAGTCCTAG
Protein Sequence
- >LOC_Os05g28210.1 protein MASGQQQQGRSELDRMAREGQTVVPGGTGGKSLEAQENLAEGRSRGGQTRKEQMGEEGYREMGRKGGLSTGDESGGERAAREGIDIDESKYKTKS*