Gene Details:
- MSU gene ID: LOC_Os06g02490
- RAPdb gene ID: Os06g0115300
- Gene Symbol: OsACBP2
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- Herein, rice OsACBP2 was demonstrated not only to play a role in seed development and germination, but also to influence grain size.
- When OsACBP2 function was investigated using OsACBP2 mutants and transgenic rice overexpressing OsACBP2 (OsACBP2-OE), OsACBP2 was retarded in germination, while OsACBP2-OEs performed better than the wild-type and vector-transformed controls, in germination, seedling growth, grain size, and grain weight.
- Deletion analysis of the OsACBP2 5’-flanking region revealed five copies of the seed cis-element, Skn-I-like motif (-1486/-1482, -956/-952, -939/-935, -826/-822, and -766/-762), and the removal of any adversely affected expression in seeds, thereby providing a molecular basis for OsACBP2 expression in seeds.
- As dietary rice bran contains beneficial bioactive components, OsACBP2 appears to be a promising candidate for enriching seed nutritional value.
- OsACBP2 mRNA accumulated in embryos and endosperm of germinating seeds in qRT-PCR analysis, while β-glucuronidase (GUS) assays on OsACBP2pro::GUS rice transformants showed GUS expression in embryos, as well as the scutellum and aleurone layer of germinating seeds.
Function-related keywords:
- grain , seedling , development , seed , grain-size , endosperm , seed-development , grain-weight
Literature:
- Subcellular localization of rice acyl-CoA-binding proteins (ACBPs) indicates that OsACBP6::GFP is targeted to the peroxisomes . DOI: 10.1111/nph.12809 ; PMID: 24738983
- Rice acyl-CoA-binding proteins OsACBP4 and OsACBP5 are differentially localized in the endoplasmic reticulum of transgenic Arabidopsis . DOI: 10.4161/psb.29544 ; PMID: 25763631
- The overexpression of rice ACYL-CoA-BINDING PROTEIN2 increases grain size and bran oil content in transgenic rice . DOI: 10.1111/tpj.14503 ; PMID: 31437323
- Crystal structure of the rice acyl-CoA-binding protein OsACBP2 in complex with C18:3-CoA reveals a novel pattern of binding to acyl-CoA esters . DOI: 10.1002/1873-3468.13923 ; PMID: 32888212
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os06g02490.1 cDNA GGCGTCCATTGATCTTCCTCCCCCCTCCAACTCCAAGAAATCGACTGACGCCAACGAGAACGAGACGCCATCGCTGCCATGGGTTTGCAGGAGGAGTTTGAGGAGTTCGCCGAGAAGGCCAAGACCTTGCCTGACACAATTTCCAACGAGGACAAGCTGCTTCTCTATGGCCTCTACAAGCAGGCAACCGTTGGCCCGGTTACCACTGGGCGCCCAGGTATTTTCAACCTGAAAGACAGATACAAATGGGATGCTTGGAAGGCCGTTGAAGGGAAATCCAAGGAGGAAGCTATGGCCGATTACATCACCAAGGTGAAGCAGCTGCTGGAGGAGGCTTCTGCATCCACTTCTTAGGCTATTATGAACAACACCATCAATAGTGCTGCATATATGTACCAATAAACATAAATACTATACCATCATCAGGCGCTTTGTGATCATCCCTTCTCTGTACTTGTAATAGTTTCAAGCAGACTCGGTCCTGTTAATTGATCATGACTGTTATTAAGTTTGTCCGTCTTTTCTAAA
CDS Sequence
- >LOC_Os06g02490.1 CDS ATGGGTTTGCAGGAGGAGTTTGAGGAGTTCGCCGAGAAGGCCAAGACCTTGCCTGACACAATTTCCAACGAGGACAAGCTGCTTCTCTATGGCCTCTACAAGCAGGCAACCGTTGGCCCGGTTACCACTGGGCGCCCAGGTATTTTCAACCTGAAAGACAGATACAAATGGGATGCTTGGAAGGCCGTTGAAGGGAAATCCAAGGAGGAAGCTATGGCCGATTACATCACCAAGGTGAAGCAGCTGCTGGAGGAGGCTTCTGCATCCACTTCTTAG
Protein Sequence
- >LOC_Os06g02490.1 protein MGLQEEFEEFAEKAKTLPDTISNEDKLLLYGLYKQATVGPVTTGRPGIFNLKDRYKWDAWKAVEGKSKEEAMADYITKVKQLLEEASASTS*