Gene Details:

Functional Descriptions:

  • These results indicate that BU1 protein is a positive regulator of BR response: it controls bending of the lamina joint in rice and it is a novel primary response gene that participates in two BR signaling pathways through OsBRI1 and RGA1.
  • Rice plants overexpressing BU1 (BU1:OX) showed enhanced bending of the lamina joint, increased grain size, and resistance to brassinazole, an inhibitor of BR biosynthesis.
  • Consistently, transcriptome analyses revealed that SDG725 depletion results in down-regulation by more than two-fold of over 1000 genes, including D11, BRI1 and BU1, which are known to be involved in brassinosteroid biosynthesis or signaling pathways.
  • In addition, compared to the wild type, the induction of BU1 by exogenous brassinolide did not require de novo protein synthesis and it was weaker in a BR receptor mutant OsbriI (Oryza sativa brassinosteroid insensitive1, d61) and a rice G protein alpha subunit (RGA1) mutant d1.
  • These results indicate that BU1 may participate in some other unknown processes modulated by BR in rice.
  • Furthermore, expression analyses showed that BU1 is expressed in several organs including lamina joint, phloem, and epithelial cells in embryos.
  • In contrast to BU1:OX, RNAi plants designed to repress both BU1 and its homologs displayed erect leaves.
  • Here, we describe a novel BR-induced rice gene BRASSINOSTEROID UPREGULATED1 (BU1), encoding a helix-loop-helix protein.

Literature:

Gene Resources:

Sequences:

cDNA Sequence
  • >LOC_Os06g12210.1 cDNA ATGTCGAGCCGGAGGTCGTCGCGCTCCTCCGTGTCGGAGGAGGAGATCAACGAGCTCATCTCCAAGCTCCAGTCCCTCCTCCCCAGCTCCCGCCGCCGCGGCGCCAACCAGGCGTCGACGACGAAGCTGCTGAAGGAGACGTGCAGCTACATCAAGAGCCTGCACCGGGAGGTGGACGACCTCAGCGACAGGCTCTCCGACCTCATGGCCGGCATGGATCACAACAGCCCAGGCGCCGAGATCATCCGCAGCCTCCTCCGCTAG
CDS Sequence
  • >LOC_Os06g12210.1 CDS ATGTCGAGCCGGAGGTCGTCGCGCTCCTCCGTGTCGGAGGAGGAGATCAACGAGCTCATCTCCAAGCTCCAGTCCCTCCTCCCCAGCTCCCGCCGCCGCGGCGCCAACCAGGCGTCGACGACGAAGCTGCTGAAGGAGACGTGCAGCTACATCAAGAGCCTGCACCGGGAGGTGGACGACCTCAGCGACAGGCTCTCCGACCTCATGGCCGGCATGGATCACAACAGCCCAGGCGCCGAGATCATCCGCAGCCTCCTCCGCTAG
Protein Sequence
  • >LOC_Os06g12210.1 protein MSSRRSSRSSVSEEEINELISKLQSLLPSSRRRGANQASTTKLLKETCSYIKSLHREVDDLSDRLSDLMAGMDHNSPGAEIIRSLLR*