Gene Details:
- MSU gene ID: LOC_Os06g16270
- RAPdb gene ID: Os06g0274000
- Gene Symbol: OsHSBP2
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- This report describes the role of OsHSBP1 and OsHSBP2 in the regulation of the HSR and seed development of rice.
- The thermotolerance assay revealed that OsHSBP1 and OsHSBP2 are negative regulators of HSR and involved in acquired thermotolerance but not in basal thermotolerance since their over-expression transgenic lines pre-heated at sublethal temperature, showed significantly decreased seedling survival after heat shock treatment.
- Furthermore, antioxidant activity and gene expression of catalase and peroxidase was significantly increased in knock-down transgenic seedlings of OsHSBP1 and OsHSBP2 after heat stress compared with the wild type.
- Overall, the present study reveals the role of OsHSBP1 and OsHSBP2 in the regulation of the HSR and seed development of rice.
Function-related keywords:
Literature:
- Functional analysis of OsHSBP1 and OsHSBP2 revealed their involvement in the heat shock response in rice (Oryza sativa L.) . DOI: 10.1093/jxb/ers245 ; PMID: 22996677
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os06g16270.1 cDNA ATGGCGGCTCCCGGCTCCGGCTCCGGCGGCATCCCTAATGCAGGCTGATCAGGACTCGGATGGCTCGGCGCAGAGCACTGCTGATATGACCGCTTTCGTGCAAAATCTTCTGATGCAGATGGTGAGTAACTTTGTTCACATGGCGGGGCGATGCGAATTTCATGCAATCACTTCACTTTTACTGAATTGTAACTTTCTTGCAGCAAACCAGGTTCCAATCTATGTCAGAGAACATCATTTCAAAGATAGATGAAATGGGCGCAAGAATTGATGAGTTGGAGCAGAGCATCAATGACCTCAAGGTTGAGATGGGCACTGAAGGTATTACCCCAACTAAGCCAAAGGACGAAGAATCGAAGCCTGCGGGTAGCTCTGCCGAATGAAAGAAACAGAAGCAGTTGAAATGGTAGCATGCCATTCCAGATTTGATTTCCGTATCGACATCTCCAGCCATTCATCACTGACAAATTACATGCTGTAAGATCTTAGCAGGGCACTTTTATGCATCTGAGATTTGTGGTAGCAGTTGAGAATCTCTCTTATAGATGTTGTTGCATGTTTTACTGTGAACTTCTCTGTGGATATTGTACTGTACTGCGCAGAGCAATGATCATAATAGGTTTGTTTAGATTCATGCGCTTGCTTCTTCGTTTGCTGATCACCAGATGGATGGCGTGTTTTCCAGATGAAACCATGGACTTTCTGTAGCTGGTTGCTACCTATGTCATTGATTGGTTCCTAATTTCCTAACTAA
CDS Sequence
- >LOC_Os06g16270.1 CDS ATGCAGGCTGATCAGGACTCGGATGGCTCGGCGCAGAGCACTGCTGATATGACCGCTTTCGTGCAAAATCTTCTGATGCAGATGGTGAGTAACTTTGTTCACATGGCGGGGCGATGCGAATTTCATGCAATCACTTCACTTTTACTGAATTGTAACTTTCTTGCAGCAAACCAGGTTCCAATCTATGTCAGAGAACATCATTTCAAAGATAGATGA
Protein Sequence
- >LOC_Os06g16270.1 protein MQADQDSDGSAQSTADMTAFVQNLLMQMVSNFVHMAGRCEFHAITSLLLNCNFLAANQVPIYVREHHFKDR*