Gene Details:
- MSU gene ID: LOC_Os06g29730
- RAPdb gene ID: Os06g0493100
- Gene Symbol: Bphi008a
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- Measurement of the expression levels of ethylene synthases and of ethylene emissions showed that BPH feeding rapidly initiated the ethylene signaling pathway and up-regulated Bphi008a transcript levels after 6 to 96 h of feeding.
- In contrast, blocking ethylene transduction (using 1-methylcyclopropene) reduced Bphi008a transcript levels in wild-type plants fed upon by BPH.
- The Bphi008a gene interacts with the ethylene pathway and transcriptionally regulates MAPK genes in the response of rice to brown planthopper feeding.
- Finally, yeast two-hybrid screening results showed that Bphi008a is able to interact with a b-ZIP transcription factor (OsbZIP60) and a RNA polymerase polypeptide (SDRP).
- We examined ways in which the Brown planthopper induced008a (Bphi008a; AY256682) gene of rice (Oryza sativa) enhances the plant’s resistance to a specialist herbivore, the brown planthopper (BPH; Nilaparvata lugens).
Function-related keywords:
Literature:
- The Bphi008a gene interacts with the ethylene pathway and transcriptionally regulates MAPK genes in the response of rice to brown planthopper feeding . DOI: 10.1104/pp.111.174334 ; PMID: 21487048
Related News:
Gene Resources:
- NCBI ID: AY256682
- UniProt accessions:
Sequences:
cDNA Sequence
- >LOC_Os06g29730.1 cDNA TAGTACATATATCAAGCATACACAAGAAGGATTTATTGAAGGCCAACCATGGCGTCTCTTAGAGCCACCACACTCCTTGTGTTGATGCAAATTATTATGGTGTTTTACACCGTCATCTTAAGCTGCTCGTTTTCTGATGCCCGAACTTTCCCAGGCGGAGAAGGTGGGTTAGACCCAAATCATCCAGTATGCGTTGGCGGCGCGTGTCCAACACCAGGTCTACCATACACTAATCCACGTGATCCTTGCATATACCGTAACAGGTGCAATCCACCAGGACGGATGGGTGATCCATAAGTAATTTTCATCATCAATATTTATCGTTGTGATCCAGTATACGTCCACATCGTCCACATGACAATAGTGTGTGTTTGTGTATGTTATACTAGTATTCACTAGCTGCTCACACTGCATGAGAGCTAGTTAATTAAGAGAATGTCTATGTATGACAAATAATGTACTGTGGTACTATATATGTATCCCCCTGTCTCGGCAATATATGGATTAATAAGACATGTGTACTCTGGATCTGATTAGTGTAATA
CDS Sequence
- >LOC_Os06g29730.1 CDS ATGGCGTCTCTTAGAGCCACCACACTCCTTGTGTTGATGCAAATTATTATGGTGTTTTACACCGTCATCTTAAGCTGCTCGTTTTCTGATGCCCGAACTTTCCCAGGCGGAGAAGGTGGGTTAGACCCAAATCATCCAGTATGCGTTGGCGGCGCGTGTCCAACACCAGGTCTACCATACACTAATCCACGTGATCCTTGCATATACCGTAACAGGTGCAATCCACCAGGACGGATGGGTGATCCATAA
Protein Sequence
- >LOC_Os06g29730.1 protein MASLRATTLLVLMQIIMVFYTVILSCSFSDARTFPGGEGGLDPNHPVCVGGACPTPGLPYTNPRDPCIYRNRCNPPGRMGDP*