Gene Details:
- MSU gene ID: LOC_Os12g43600
- RAPdb gene ID: Os12g0632000
- Gene Symbol: Osgr-rbp4 Osgrp1
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- Osgr-rbp4 transcript in rice seedlings is constitutively expressed as well as regulated by different abiotic stresses including high temperature stress.
- Ectopic over-expression of Osgr-rbp4 cDNA imparts high temperature stress tolerance to wild type yeast cells.
- Thus, the expression of the Osgrp1 gene is closely associated with cell elongation/expansion during the post-mitotic cell differentiation process.
- Expression of the rice Osgrp1 promoter-Gus reporter gene is specifically associated with cell elongation/expansion and differentiation.
- The Osgrp1-Gus gene was also expressed in response to wounding and down-regulated by water-stress conditions in the elongation region of roots.
- It is shown that Osgr-rbp4 in rice leaf cells and its immunologically homologous protein in tobacco BY2 protoplasts are nuclear proteins.
- To study the expression and regulation of a rice glycine-rich cell wall protein gene, Osgrp1, transgenic rice plants were regenerated that contain the Osgrp1 promoter or its 5’ deletions fused with the bacterial beta-glucuronidase (GUS) reporter gene.
Function-related keywords:
- temperature , cell-elongation , root , leaf , cell-wall , seedling , abiotic-stress
Literature:
- Molecular characterization of a novel isoform of rice (Oryza sativa L.) glycine rich-RNA binding protein and evidence for its involvement in high temperature stress response . DOI: 10.1016/j.plantsci.2007.04.010
- Expression of the rice Osgrp1 promoter-Gus reporter gene is specifically associated with cell elongation/expansion and differentiation . DOI: 10.1007/BF00020394 ; PMID: 7632916
Related News:
Gene Resources:
- NCBI ID: AJ002893
- UniProt accessions:
Sequences:
cDNA Sequence
- >LOC_Os12g43600.1 cDNA CCCCGTGGTCTCTCAGAGGTGGGTTGGCTTCTCCTCCCCCTCCCGGTTCGGTTCGGTTCGGGTCCGGTTCGATTTCGTTTTTTTTTCTTCTTCGTGGGGTTGGTGGGAAAGCATGGCGGCGCCGGATGTTGAGTACCGCTGCTTCGTCGGCGGCCTCGCCTGGGCCACCGACGACCGCTCCCTCGAAGCCGCCTTCTCCACCTTCGGCGAGATCCTCGAGTCCAAGATCATCAACGATCGGGAGACGGGGAGGTCGCGCGGGTTCGGGTTCGTGACGTTCTCGAGCGAGCAGGCCATGCGCGACGCCATCGAGGGGATGAACGGCAAGGAGCTCGACGGCCGCAACATCACCGTCAACGAGGCCCAGTCGCGCCGCTCCGGAGGCGGAGGCGGAGGCGGCTACGGCCAGCGCGGCGGAGGCGGAGGCTACGGTGGCGGCGGCGGCTACGGTGGTGGCGGCGGCGGTGGCTACGGCCAGCGCCGTGAAGGCGGCTACGGCGGTGGCGGCGGCTACGGTGGCGGCCGTGGCGGCGGCGGCGGCTACGGCGGTGGCTACGGCAGCCGCGGCGGCGGCAACTCCGACGGGAACTGGAGGAACTGAGCGGTGGGGCCCTCATGGCCAAGTTATCTATCTATCTAATCGAGCTACCATCATCATCATCCGATCGTTATCATCGTTAGTTTTGTGTGGAACTACTATCTAGTTTGTGTTACTGTGTGGTTGCCCATCTGTGTTTTTGATCGCAAGAAGAAAGCTCGTCTCGTGTTTGCTTTGATCAAATGAAATGAATGAATGAATCTTAGTGTGCTCCGCTCTCGTCAAATCCATCGAATTATTTAATTTGTCATGGTTGTGAATCATGG
CDS Sequence
- >LOC_Os12g43600.1 CDS ATGGCGGCGCCGGATGTTGAGTACCGCTGCTTCGTCGGCGGCCTCGCCTGGGCCACCGACGACCGCTCCCTCGAAGCCGCCTTCTCCACCTTCGGCGAGATCCTCGAGTCCAAGATCATCAACGATCGGGAGACGGGGAGGTCGCGCGGGTTCGGGTTCGTGACGTTCTCGAGCGAGCAGGCCATGCGCGACGCCATCGAGGGGATGAACGGCAAGGAGCTCGACGGCCGCAACATCACCGTCAACGAGGCCCAGTCGCGCCGCTCCGGAGGCGGAGGCGGAGGCGGCTACGGCCAGCGCGGCGGAGGCGGAGGCTACGGTGGCGGCGGCGGCTACGGTGGTGGCGGCGGCGGTGGCTACGGCCAGCGCCGTGAAGGCGGCTACGGCGGTGGCGGCGGCTACGGTGGCGGCCGTGGCGGCGGCGGCGGCTACGGCGGTGGCTACGGCAGCCGCGGCGGCGGCAACTCCGACGGGAACTGGAGGAACTGA
Protein Sequence
- >LOC_Os12g43600.1 protein MAAPDVEYRCFVGGLAWATDDRSLEAAFSTFGEILESKIINDRETGRSRGFGFVTFSSEQAMRDAIEGMNGKELDGRNITVNEAQSRRSGGGGGGGYGQRGGGGGYGGGGGYGGGGGGGYGQRREGGYGGGGGYGGGRGGGGGYGGGYGSRGGGNSDGNWRN*