Gene Details:

Functional Descriptions:

  • SlERF.F12 modulates the transition to ripening in tomato fruit by recruiting the co-repressor TOPLESS and histone deacetylases to repress key ripening genes.
  • SlERF.F12, a member of the ERF.F subfamily containing Ethylene-responsive element-binding factor-associated Amphiphilic Repression (EAR) motifs, negatively regulates the onset of tomato (Solanum lycopersicum) fruit ripening by recruiting the co-repressor TOPLESS 2 (TPL2) and the histone deacetylases (HDAs) HDA1/HDA3 to repress the transcription of ripening-related genes.
  • SlERF.F12 interacts with the co-repressor TPL2 via the C-terminal EAR motif and recruits HDAs SlHDA1 and SlHDA3 to form a tripartite complex in vivo that actively represses transcription of ripening genes by decreasing the level of the permissive histone acetylation marks H3K9Ac and H3K27Ac at their promoter regions.
  • We demonstrate that SlERF.F12 negatively regulates the onset of tomato fruit ripening by recruiting the co-repressor TOPLESS protein 2 (TPL2) and the histone deacetylases (HDAs) HDA1/HDA3 to repress the transcription of ripening-related genes.

Literature:

Gene Resources:

Sequences:

cDNA Sequence
  • />Solyc02g077840.2.1
    ATGGCTTCCACTCGTGAGGGTCACTACAGAGGAGTGAGAAAGCGTCCCTGGGGCCGTTACGCCGCAGAGATTCGCGACCCGTGGAAGAAAACACGTGTCTGGTTAGGCACTTTCGACACTCCAGAAGAAGCGGCACTCGCTTACGACGGCGCCGCCCGTTCACTCCGCGGCGCTAAAGCAAAAACAAACTTCCCCCTCCTCCGCCGCCGCCGCCGCAGCCTTCTTCCGCTCCTCTTACACTCGATCTCAACCTTCCATCTGATCACCGGTGGACTTCCCCCTCCGGACGTAGGCTCATGATTGGAGAGTTTCTACAAGTAGGTCCGCCGCCGGAACTTAACTTGCCGGTCACCGTCGCTGCGCCGGCGAAGGAAAACGATGTTGGAGCTGCAGCTATGTATTTTGGGATTGTGAGACGTGGGTTGCCTATTGACTTGAACGAACCGCCGCCGTTGTGGATGTGA
CDS Sequence
  • />Solyc02g077840.2.1
    ATGGCTTCCACTCGTGAGGGTCACTACAGAGGAGTGAGAAAGCGTCCCTGGGGCCGTTACGCCGCAGAGATTCGCGACCCGTGGAAGAAAACACGTGTCTGGTTAGGCACTTTCGACACTCCAGAAGAAGCGGCACTCGCTTACGACGGCGCCGCCCGTTCACTCCGCGGCGCTAAAGCAAAAACAAACTTCCCCCTCCTCCGCCGCCGCCGCCGCAGCCTTCTTCCGCTCCTCTTACACTCGATCTCAACCTTCCATCTGATCACCGGTGGACTTCCCCCTCCGGACGTAGGCTCATGA
Protein Sequence
  • />Solyc02g077840.2.1
    MASTREGHYRGVRKRPWGRYAAEIRDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPLLRRRRRSLLPLLLHSISTFHLITGGLPPPDVGS*