Gene Details:
- Gene ID: Zm00001eb067570
- Gene Symbol: ZmIBH1-1 ibh1
- Gene Name: increased leaf inclination1-binding bhlh 1
- Genome: Zm-B73-REFERENCE-NAM-5.0
- Species: Zea mays
Functional Descriptions:
- We propose a regulatory model for the control of plant architecture by ZmIBH1-1 in maize.
- ZmIBH1-1 directly regulates genes involved in cell wall modification, cell development, and hormone responses.
- ZmIBH1-1, which encodes a bHLH transcription factor with both a basic binding region and a helix-loop-helix domain, and the results of qRT-PCR showed that it is a negative regulator of LA.
- The combined results revealed 59 ZmIBH1-1-modulated target genes with annotations, and they were mainly related to the cell wall, cell development, and hormones.
Function-related keywords:
- transcription-factor , development , plant-development , architecture , cell-wall , transcription-regulator , plant-architecture
Literature:
- ZmIBH1-1 regulates plant architecture in maize. DOI: 10.1093/jxb/eraa052 ; PMID: 31990030
- Striking a growth-defense balance: Stress regulators that function in maize development. DOI: 10.1111/jipb.13570 ; PMID: 37787439
Related News:
Gene Resources:
- NCBI ID: 100278153
- UniProt accessions: A0A804M8X4
Sequences:
cDNA Sequence
- >Zm00001eb067570_T001 CACCCCCCCTCTCTCTCTCTCACCTTCCTCCTCTCTCCTCCTCCCGCCTGCCTTTTAAGCGACGCGCCCACCTCCCACCGCACCCTCTCTCTCTCTCTGATCGGTCGTCCTTCCTCCACCCGTCTGCCCCCTCCTCCGCGCCGCGCCTGTTCATGGCCAGGAAGAGGACGGCGGCGCGCCATCAGCACCAGGAACCACCGCCAAACCCTAACCCTAACCTCCGCCGCCGGGCCGCGGCCAGCGACCCGGCCTCGGACGAGCCGCCGCCGTCGTCGAAGCGCATGCTGGCCTTTCACTTCCTCCGCGCGCTGGCCAGGATCCACAGCACCACCCCGGCGCCGCGCCGCCCGCGCACCATCCGCCGCGCGGCCTACTCGTCCATGGCGCGCGCTGCCAGCCCACGCCGGGCCTGGACGCAGGCGCTGCTCCGCCAGGCTCGCGCGCGCAGGGCGGCTGCCAG
CDS Sequence
- >Zm00001eb067570_T001 ATGGCCAGGAAGAGGACGGCGGCGCGCCATCAGCACCAGGAACCACCGCCAAACCCTAACCCTAACCTCCGCCGCCGGGCCGCGGCCAGCGACCCGGCCTCGGACGAGCCGCCGCCGTCGTCGAAGCGCATGCTGGCCTTTCACTTCCTCCGCGCGCTGGCCAGGATCCACAGCACCACCCCGGCGCCGCGCCGCCCGCGCACCATCCGCCGCGCGGCCTACTCGTCCATGGCGCGCGCTGCCAGCCCACGCCGGGCCTGGACGCAGGCGCTGCTCCGCCAGGCTCGCGCGCGCAGGGCGGCTGCC
Protein Sequence
- >Zm00001eb067570_P001 MARKRTAARHQHQEPPPNPNPNLRRRAAASDPASDEPPPSSKRMLAFHFLRALARIHSTTPAPRRPRTIRRAAYSSMARAASPRRAWTQALLRQARARRAAA